Conserved Protein Domain Family
DUF1154

?
pfam06631: DUF1154 
Protein of unknown function (DUF1154)
This family represents a small conserved region of unknown function within eukaryotic phospholipase C (EC:3.1.4.3). All members also contain pfam00387 and pfam00388.
Statistics
?
PSSM-Id: 399553
View PSSM: pfam06631
Aligned: 24 rows
Threshold Bit Score: 36.8646
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_028037208  841 IVFEPITVESLRQEKGFLKTGRKQQKDLDAMRKRHAKEKMALQK 884  wild silkworm
1_pfamImport    1 LVFESVTLESIKNEKQFAKIARKQSKDLEILKKKHTKERLAVQK 44  
XP_001992285  865 LVFEPVTLESLRQEKGFQKVGKKQIKELDTLRKKHAKERTSVQK 908  Drosophila grimshawi
Q16W08        853 IVFDPITVESLRQEKGFQKTAKKQQKELDSVKKKHAKERTGVQK 896  yellow fever mosquito
3_pfamImport    2 ITFEIITIEILKNEKAYLKITRKQQKELDAMQKRHLKERMLVQK 45  
XP_016836692  871 LNFEPITIEVLRHEKGYVKVTRKQQKELESLKKKHQKERFSIQK 914  jewel wasp
XP_015785059  851 TQMKPISLENLRNDKIYLKLIKKQDKVIEGLRKKHHKEKQGIQK 894  two-spotted spider mite
EFX75407      844 MKFEPVTLESLRSDKAFAKATKKHQKDLDSMRKRQQKEKATIQK 887  common water flea
XP_001948241  868 IKFENINLEYLRNDKGFQKARRKQEKELETLRKRQAKEKSAIQK 911  pea aphid
EFN74018      874 MKFDPITLETLRQEKGYQKVLRKQQKELESLRKRHHKEKLTVQK 917  Florida carpenter ant
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap