2JRT,2OA4


Conserved Protein Domain Family
DUF1153

?
pfam06627: DUF1153 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1153)
This family consists of several short, hypothetical bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 399550
View PSSM: pfam06627
Aligned: 26 rows
Threshold Bit Score: 129.302
Threshold Setting Gi: 123380212
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2JRT_A                      7 DGPRQVTLPDGTVLSRADLPPLDTRRWVASRKAAVVKAVIHGLITEREALDRYSLSEEEFALWRSAVAAHGEKALKVTMI 86  Rh...
WP_007675208               10 RGEKYVIGPTGAPLTLSDLPPPETQRWVIRRKAEVVAAVRGGLLSLDEACDRYKLTNEEFLAWQQSIDRHGLAGLRTTRL 89  Pr...
WP_012178179                7 SGPASVTLPDGSIMTRSDLPDRNTRRWVASRKAAVVKGVMSGLISEEEACRWYGLSEEEFASWLSAIESHGLKGLKATKL 86  Di...
Q28PD9                      7 QGPHTVTLPDGSNMTRSDLPPPDTTRWVASRKASVVRAVDYGLLSAEEAIRTYALSEEELEAWRVAVEKHGVRALKTTAI 86  Ja...
DSMZRoselon:roselon_02640   7 KGPHAVTLPDGRLLTRADLPPPDTCRWVASRKALVVQAVDSGLISAEEAIRTWSLSDEELEGWRRAVARHGVAALKATSV 86  Ro...
ADO42683                    7 DGPRLVTLPDGTVMTRADLPPANTRRWVASRKAAVIHAIRGGLISREQAMERYALSSDELCEWEKAVENFGTAALRATAL 86  Ke...
Q166E2                     17 DGPRSVTLADGTVMTQADLPPVTTRRWVASRKAAVVRGVAYGLIPQKEALSRYRISEDEFHEWVKAVSEHGEDALKATTL 96  Ro...
2OA4_A                      8 EGPRSVTLPDGSIMTRADLPPANTRRWVASRKIAVVRGVIYGLITLAEAKQTYGLSDEEFNSWVSALAEHGKDALKVTAL 87  Ru...
WP_013067386                7 DGPRAVTLPDGTILTRADLPPKETRRWVASRKAIIVHAVTHGLIGRSEVLERYGLSEEEFDIWAEAVKKHGIAGLKVTAI 86  Rh...
jgi:Pden_4097               7 PGPRIVTLPDGSILTRADLPEPQT-RWVASRKAAVVDAVHHGLLTRDEAIRRYGLTEEEFDAWASAFRRHGRNALKITQL 85  Pa...
2JRT_A                     87 QKYR 90  Rhodobacter sphaeroides
WP_007675208               90 QQYR 93  Proteobacteria
WP_012178179               87 QEYR 90  Dinoroseobacter shibae
Q28PD9                     87 QQFR 90  Jannaschia sp. CCS1
DSMZRoselon:roselon_02640  87 QRFR 90  Roseibacterium elongatum DSM 19469
ADO42683                   87 KKYR 90  Ketogulonicigenium vulgare Y25
Q166E2                     97 QKYR 100 Roseobacter denitrificans OCh 114
2OA4_A                     88 KKYR 91  Ruegeria pomeroyi
WP_013067386               87 QKYR 90  Rhodobacter
jgi:Pden_4097              86 QKFR 89  Paracoccus denitrificans PD1222
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap