Conserved Protein Domain Family
SepQ

?
pfam06622: SepQ 
SepQ protein
This family consists of several enterobacterial SepQ proteins from Escherichia coli and Citrobacter rodentium. The function of this family is unclear.
Statistics
?
PSSM-Id: 115292
View PSSM: pfam06622
Aligned: 2 rows
Threshold Bit Score: 638.235
Threshold Setting Gi: 75407611
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q93FK4         1 MKPLNSQSNMKINDFYLPLLPVIGIGRLYITSEGHACHAYFREVSGNGFRFTLAYSGYEGCFWVSEEQLTQWCHELFPYS 80  Citrobacter rod...
WP_001050796   1 MNLLNSQLNMKINDFYLPLLSVIGTGRLYITPEGHACHAYFREVSGNGIRFTLTCSGYEGRFWISEEQFIQWCQELFPYS 80  Escherichia
Q93FK4        81 DSRLIPEDTIKLMLLWAIHATLPEDDASVDDVQFTTLNKDIYPVIENNNGKNRLNVIILKTTVQSLQYLINDNWQLVPHS 160 Citrobacter rod...
WP_001050796  81 ESRLIPEDMIKLMILWVMQTALPEGDVSVDDVQFTMLNKDVYPVIENNNGENRLNVIILEITVQSLQYLINENWQFVPHS 160 Escherichia
Q93FK4       161 NTLFFDGYIAPGWTDYPITKLSIGDSLRLYHVDDSQERKCWLVINNPLATVKLSDNNLSVTDVQAADPLCIISNETVMNR 240 Citrobacter rod...
WP_001050796 161 NTIFFDGYIAPGWTDYPVTELTVGDSLRLYHVDDSKERECWLVINNPLATVKLCDNNLFIADVQAADLLCTISNEAVMDR 240 Escherichia
Q93FK4       241 IYCAIGTINVDIHKLRNLKKDDTIGSVGYHLFGGGRLIRNNTIIAYGTIIKINEDFYSNISVVCD 305 Citrobacter rodentium
WP_001050796 241 IYCVIGTIHVDIHMLRNAKKDDIIDSTGYHLFGGCRLIRNNTTIAYGSIVKINEDFYFTVSLVCD 305 Escherichia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap