2O2A


Conserved Protein Domain Family
DUF1149

?
pfam06619: DUF1149 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1149)
This family consists of several hypothetical bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 399543
View PSSM: pfam06619
Aligned: 18 rows
Threshold Bit Score: 123.922
Threshold Setting Gi: 122397306
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2O2A_A                  4 EVIREQEFVNQYHYDARnlewEEENGTPKTNFEVTFQLANRDE-------AAKVTSIVAVLQFVIVRDE--FVISGVISQ 74  Strept...
CCO10371                2 NVLRGQIQVEKYNFEL-----ATGSSAAETKVEVLINEVVPTEead-kgiLEEGKMFRMEVPFALQLER--FKIDGQISQ 73  Carnob...
Q8Y9W2                  2 DIVTNKIVVEKYNFETi----VEENEQFENKIELEVHEVEPVNgnv--elMSKGKIFKITIPFLLVLEN--FRIDGRISR 73  Lister...
Q38YE6                  2 QTKKDPISVDAFHFDR-----VSPDAEPQQNIQVSLVKIDADDeylqeadLKAGNIYQIVTPFQVMPQGsgFAVSGQISR 76  Lactob...
Q5FL89                  3 feKQTPVTVQSFHYDL-----VDEGVAAKSEVNPGIRKLDVSGdde--hsEEEGSYYDVAVFFDVIPAPaeFEVSGAIHQ 75  Lactob...
WP_013773574            2 EIERQQELVEAFHYATItpeiKNE--DRKTELNIGMSPIEPTEd-----eSGENSILAVRLDFQLVFDE--CILSGAISQ 72  Meliss...
Prjna32935:ECBG_00860   2 ELKRQQPIVEAYHFDM-----KPKDKEMETKLNVGFAPLKVKDee----yMEKNSIIGARLEFQLVFPD--YVLSGRVGQ 70  Entero...
BAK94840                2 EIKRQQPLVEAYHFDQR----KKEEADLQTGINIGLTPLKAPDes----yPKENSIIGTRLRFEIVFSQ--FIIRGAMGQ 71  Tetrag...
WP_002291995            2 EIRRQKEVVEAFHYDMR----LPNQ-EVETDLKVGFSPLKETIen----yPKEHSIVGARLEFRLVFDT--YVLSGSVSQ 70  Firmic...
Q837T8                  2 EIKRQQEIVEAYHYDMR----VPDS-EVETDLRVSFSPIEVEEen----yPENSSALVARLEFRIVFDE--FVLSGAISQ 70  Entero...
2O2A_A                 75 XAHIQGRLINEPSEFSQDEVENLAAPLLEIVKRLTYEVTEIALDRPGVTLEF 126 Streptococcus agalactiae 2603V/R
CCO10371               74 IIQIPE-FFGVPSEIAVEDMRELSRPLIKYIERLTYEVTEIAFDEPGFALNF 124 Carnobacterium maltaromaticum LMA28
Q8Y9W2                 74 IIQLKD-FFGDFSDLEAVDVEGLSNPLIDYIKRLTYDVTEIAFDEPGVSLDF 124 Listeria monocytogenes
Q38YE6                 77 VVQLLD-FFGTPDEIEQKEMMKLSRPLIEYIETLTYQVTAVALNE-GIQLQF 126 Lactobacillus sakei subsp. sakei 23K
Q5FL89                 76 IVQIKN-YHGDGTDISNADWQLLSRPLVEYIETLTYEVTQVTFDKP-VNLNF 125 Lactobacillus acidophilus
WP_013773574           73 INHIINRKIKAQEDVTSSEVDQLAAPLFDIVKRLVYEVTEIALDKPGMQLNF 124 Melissococcus plutonius
Prjna32935:ECBG_00860  71 VNHILNRKVNSGEDLTKAETDRLVEPLFDIVKRLTYEVTEIVTDKPGLQLNF 122 Enterococcus casseliflavus EC20
BAK94840               72 INHIVNQNIQSQDDLTREEIDELMDPLFDILQRLTYEVTEIITDKPGVNLDF 123 Tetragenococcus halophilus NBRC 12172
WP_002291995           71 INHILNRKIEGQNDVTQEEVDELVAPLFDIVRRMSYEVTEIALDQPGVKLNF 122 Firmicutes
Q837T8                 71 INHIIDRKIEKQEDISQEEVDELVRPLFSIVERLSYEVTEIALDRPGVQLNF 122 Enterococcus faecalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap