
Conserved Protein Domain Family

pfam06619: DUF1149 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1149)
This family consists of several hypothetical bacterial proteins of unknown function.
PSSM-Id: 399543
Aligned: 18 rows
Threshold Bit Score: 123.922
Threshold Setting Gi: 122397306
Created: 11-May-2020
Updated: 7-Aug-2020
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
CCO10371               74 IIQIPE-FFGVPSEIAVEDMRELSRPLIKYIERLTYEVTEIAFDEPGFALNF 124 Carnobacterium maltaromaticum LMA28
Q38YE6                 77 VVQLLD-FFGTPDEIEQKEMMKLSRPLIEYIETLTYQVTAVALNE-GIQLQF 126 Lactobacillus sakei subsp. sakei 23K
Q5FL89                 76 IVQIKN-YHGDGTDISNADWQLLSRPLVEYIETLTYEVTQVTFDKP-VNLNF 125 Lactobacillus acidophilus
BAK94840               72 INHIVNQNIQSQDDLTREEIDELMDPLFDILQRLTYEVTEIITDKPGVNLDF 123 Tetragenococcus halophilus NBRC 12172
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap