Conserved Protein Domain Family
Circovir2_Orf1

?
pfam06615: Circovir2_Orf1 
Circovirus 2, Orf1
This family consists of short Circovirus proteins of unknown function, including ORF1 (also known as Protein NS0) which may be involved in host modulation.
Statistics
?
PSSM-Id: 115285
Aligned: 3 rows
Threshold Bit Score: 89.3366
Created: 22-Mar-2022
Updated: 13-Oct-2022
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O92288  1 MYTSLWGHLGVVKANGLLILQTRKPHTGNHLKTSGGMVTMVKKWLLLMTFMAGCRGMIY 59  Porcine circovirus
Q9YQX2  1 MSTSLWGHLGVVKANGLLILQTRKPHTGNHLETSGGMVTMVKKWLLLMTFMAGCRGMIY 59  Porcine circovirus type 2-B
Q9YQS9  1 MYTSLWGHLGVAKANGLLILQTRKPHTGNHLETSGGMVTMVKKWLLLMTFMAGCRGMIY 59  Porcine circovirus type 2-D
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap