Conserved Protein Domain Family
Neuromodulin

?
pfam06614: Neuromodulin 
Neuromodulin
This family consists of several neuromodulin (Axonal membrane protein GAP-43) sequences and is found in conjunction with pfam00612. GAP-43 is a neuronal calmodulin-binding phosphoprotein that is concentrated in growth cones and pre-synaptic terminals.
Statistics
?
PSSM-Id: 369001
View PSSM: pfam06614
Aligned: 5 rows
Threshold Bit Score: 108.326
Threshold Setting Gi: 462694
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003763652  70 KKEEAAATTEAVEKKaSD------APAATEAAPAAGAKPEEASKAGETPSEE--KEAGtqAAASEQAAPKAT-------- 133 Tasmanian devil
XP_001107824  67 NKKDEAPVADGVEKK-GE------GTTATEAAPATGSKPDEPGKAGETPSEEk-KGEG--DAATEQAAPQAP-------- 128 Rhesus monkey
P35001        69 DKKDEGPAGGRAENKeSE------ASTATEASAADSAQLDEGSKDSSVPTEEk-KGNGaaDTGSEQPAPQAAtp------ 135 chicken
EHA98380     128 EKKEDAPVADGVAKKeGE------GPATAEVTKGVGPKSEQPGKAGDAASEEkgKGEGapDAAPGQAAPQA--------- 192 naked mole-rat
XP_021576298  55 KKGDAQAAEAEANEKkEEapaaexKEGEGPAAEGAPAKADVAGKAGDTPSEEk-KAEG------------APdaapeqaa 121 thirteen-lined ...
XP_003763652 134 ----APSEEKMASAE-TESATKASTDNSPSSKAEDAPAKEEPKQADVPAA--V--PAAATTPAAEDAAEKATAQPQTETA 204 Tasmanian devil
XP_001107824 129 ----ASSEEKAGSAE-TESATKASTDNSPSSKAEDAPAKEEPKQADVPAA--Vt-AAAATTPAAEDAAAKATAQPPTETG 200 Rhesus monkey
P35001       136 ---aASSEEKPAAAAeTESATKASTDNSPSLKADEAKTK---RSLNKPTCllLt-PLATTTPAAEDATAKARLQPQMETV 208 chicken
EHA98380     193 ------AEEKAGSVE-TESAAKASPDNLPSSKAEDGPAKEEPKQADVPAA--VtaAAAATTPAAEDAAAKATAQPPTDTA 263 naked mole-rat
XP_021576298 122 aqapAPSEEKAGSAE-TESAAKASTDNSPSSKAEDVSakEEPKQADVPAA--Vt-AAAATTPAAEDAAVKATAQPPTETA 197 thirteen-lined ...
XP_003763652 205 ESSKAEEKTEAVEETKPMESAQQEEEKGDESKADQEHA 242 Tasmanian devil
XP_001107824 201 ESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA 238 Rhesus monkey
P35001       209 ESSQTEEKTDAVEETKPTESAQQEEVKEEESKADQENA 246 chicken
EHA98380     264 ESSQAEEKLEAVDETKPKESARQDEGKEEEREADQEHA 301 naked mole-rat
XP_021576298 198 ESSQAEEKIEAVDETKPKESARQDEGKEEEREADQEHA 235 thirteen-lined ground squirrel
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap