Conserved Protein Domain Family
DUF1145

?
pfam06611: DUF1145 
Protein of unknown function (DUF1145)
This family consists of several hypothetical bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 399539
View PSSM: pfam06611
Aligned: 32 rows
Threshold Bit Score: 32.9672
Threshold Setting Gi: 81541776
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q47YL0           5 IIHSTKALLTGLWILAILGLasINPLPVEYQLYLLPLAGIVLLAHLLEYFAMKAKVKT 62  Colwellia psychrerythraea 34H
jgi:Psefu_3344   4 iaRLGKLLATLFWCVILANL--ISPFAQPFAQLLNVAGVAMLGLHLVELVLFKTELGA 59  Pseudomonas fulva 12-X
jgi:Pmen_1370    3 LLSFAKGALAMFWLVALLNL--FYPFAAPLGGWVNWAALAVLLAHVGELVLFGSRLRG 58  Pseudomonas mendocina ymp
Q9I5J1           4 FLSFAKGALAMFWLVALVNL--AYPL-GELHRPILLLSGVLVLVHAAEILLLNGRLKA 58  Pseudomonas aeruginosa
Q9I4T2           4 FLGLGKLVTLVFWGAVLVNL--LHPFAYPLNWLLSIAGGLILLIHLIEILVLGGRLKA 59  Pseudomonas aeruginosa
BAN47324         4 FMGLGKVVALLFWLVVVVNL--LSPFAKPFDMLLSGAGILLVLVHLFEIMLFNSRLRG 59  Pseudomonas resinovorans NBRC 106553
jgi:Pmen_1424   32 LLIAGKALTLSFWLVFGAAL--VKWVGPPFEQLIHLLAAFLLVLHGVQLWLFADTLTG 87  Pseudomonas mendocina ymp
Q87XQ1           4 FWGLGKVLMLGFWLVVLINA--VIEAPSPFGVMIDMAGAVLLLTHLLELFLFNGSLRG 59  Pseudomonas syringae pv. tomato
Q4KH78           4 LWGLGKFLTLVFWLVVLINL--ARPLINPLHLLVNLAGSLLLLTHLLELLLFNGSLKD 59  Pseudomonas protegens Pf-5
Q88NT1           4 ILGLGKVLTVAFWGVVLFNQ--LMPQPLPFNLLINAAGIVLFGLHLLEVLFFNRSLRG 59  Pseudomonas putida KT2440
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap