Conserved Protein Domain Family
DUF1145

?
pfam06611: DUF1145 
Protein of unknown function (DUF1145)
This family consists of several hypothetical bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 429030
Aligned: 26 rows
Threshold Bit Score: 36.06
Threshold Setting Gi: 81541776
Created: 27-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Sama_3470    4 LIMFGKLATLGAWVMMGYNLLTPFDGNIGTLLKILLGVTVVMHSFQLGVFHLLFKK 59  Shewanella amazonensis SB2B
jgi:Pmen_1424   32 LLIAGKALTLSFWLVFGAALVKWVGPPFEQLIHLLAAFLLVLHGVQLWLFADTLTG 87  Pseudomonas mendocina ymp
CCU70688         2 FTIMNKAATLVFWALVLTATVQGWTG-VAGWLPTIGLVVAGIHVLEVLFFLAAFRS 56  Thalassolituus oleivorans MIL-1
Q9I5J1           4 FLSFAKGALAMFWLVALVNLAYPL-GELHRPILLLSGVLVLVHAAEILLLNGRLKA 58  Pseudomonas aeruginosa
jgi:Pmen_1370    3 LLSFAKGALAMFWLVALLNLFYPFAAPLGGWVNWAALAVLLAHVGELVLFGSRLRG 58  Pseudomonas mendocina ymp
Q9I4T2           4 FLGLGKLVTLVFWGAVLVNLLHPFAYPLNWLLSIAGGLILLIHLIEILVLGGRLKA 59  Pseudomonas aeruginosa
BAN47324         4 FMGLGKVVALLFWLVVVVNLLSPFAKPFDMLLSGAGILLVLVHLFEIMLFNSRLRG 59  Pseudomonas resinovorans NBRC 106553
jgi:Psefu_3344   4 iaRLGKLLATLFWCVILANLISPFAQPFAQLLNVAGVAMLGLHLVELVLFKTELGA 59  Pseudomonas fulva 12-X
Q88NT1           4 ILGLGKVLTVAFWGVVLFNQLMPQPLPFNLLINAAGIVLFGLHLLEVLFFNRSLRG 59  Pseudomonas putida KT2440
Q87XQ1           4 FWGLGKVLMLGFWLVVLINAVIEAPSPFGVMIDMAGAVLLLTHLLELFLFNGSLRG 59  Pseudomonas syringae pv. tomato
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap