Conserved Protein Domain Family
AlaE

?
pfam06610: AlaE 
L-alanine exporter
AlaE is a family of Gram-negative amino-acid transporters. It is not entirely clear why bacteria export metabolites but recent studies have shown that many excrete alanine. AlaE is likely to be the exporter protein for L-alanine. UniProtKB:A8ANM6, UniProt:G4R961 and UniProt:H5SVY7 are classified as putative alanine exporters.
Statistics
?
PSSM-Id: 399538
View PSSM: pfam06610
Aligned: 10 rows
Threshold Bit Score: 172.996
Threshold Setting Gi: 123590009
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6D0H3            3 SPTS---RLRSATADTFALVVYCFIIGMAIEIMLSGMSFEQSLSSRLLSIPVNIAIAWPYGLYRDRVLNVAKRHGGDHFF 79  Pectobacteri...
IEC:ABF-0018275   3 SPVS---RVRGIVADTVAMVVYCFLTGMAIEILLSGMTFQQSLSSRLLSIPVNIVIAWPYGLYRDRIVALALRLNADLRW 79  Dickeya dada...
WP_002444381      3 SRES---RLRHAAADIFAMVVYCFIVGMAIEILMSGMTFQQSLSSRLVSIPVNILIAWPYGLYRDGFMKLAKRGGNAG-W 78  Shimwellia b...
Q0WJC2            5 STGP---RWRSAVADTFALVVYCFVIGMAIEVVISGMTFRQSLSSRLLSIPVNILIAWPYGMYRDAFIRFAQRHAGQRFW 81  Yersinia pestis
HuoZJU:KKY_2433   1 mANQ---RLRSFAADTLALVIFFTIVSGLNERFIAGMSWPEVATSRAIGAPLMVLTARPYGYWRDWFLK---ITSPASTT 74  Pelagibacter...
Q3IW22            1 --------MRLFIIDTVATVIFFTAVATFSELLIAGMAPSEVLATRLLMVPVMVLTGRPYTRWRDWLVR---RTAPRNRW 69  Rhodobacter ...
Q6LP61            1 MSVKgqfNMRNAAADTFAMVIFSFITGMMIEVFVSGMTFEQSLASRTLSIPVNIAIAWPYGVFRDYLLRTGHRLSPSS-W 79  Photobacteri...
Q87QS9            1 MKSRgpfCIRHAAADTFAMVVFCFITGMIIEILISGMTFEQSLASRTLSIPVNIAIAWPYGMFRDWVLRQGNKLSPSS-F 79  Vibrio parah...
Q5E684            1 MSKKgpfNIRNAAADTFAMVVFCFITGMFIEILISGMTFEQSLASRTLSIPVNIAIAWPYGVFRDFMLRQGARISPSK-F 79  Aliivibrio f...
WP_025423488      3 aESS---RLRSAAADTFALVVYCFFTGMAIEILLSGMSLQQSLSSRLLAIPVNVIIAWPFGQYRDAVLRLGWLHGPKQFW 79  Sodalis prae...
Q6D0H3           80 VRSVADLFAYVSFQSPVYAAILWVIGASPAQILTAVTSNLVISMVMGVTYGYFLEYCRRLFRV 142 Pectobacterium atrosepticum
IEC:ABF-0018275  80 GKNMADLFAYVSFQSPVYAAILLTIGADPSQILKAVASNAVISMFMGVAYGYFLEYCRRLFRV 142 Dickeya dadantii 3937
WP_002444381     79 MRNLADITAYVTFQSPVYGAILWSVGADTQQIIAAVSSNALATMLMGAAYGYFLDYCRRLFRV 141 Shimwellia blattae
Q0WJC2           82 ARNLADLLAYVSFQSPVYAMILWSVGADFEQMISAVASNAVVSMVMGVAYGYFLEYCRRLFRV 144 Yersinia pestis
HuoZJU:KKY_2433  75 ATIIMDSIALLGFQVPIYVLIIFAGGARGMGIVTGALGFAALMLVLGRPYGLWLEFVRSRFGl 137 Pelagibacterium halotolerans B2
Q3IW22           70 SAFLTDILAFLSFQAPVYGATLLIAGASFAEAGTAIGSAIILMILLARPFGLFVEWTRSLFGV 132 Rhodobacter sphaeroides 2.4.1
Q6LP61           80 MKGLSDMVAYVLFQSPVYACILLAVGAGTDQIITAVTSNAFVSGALGIVYGQFLDACRRMFKV 142 Photobacterium profundum SS9
Q87QS9           80 MKNVSDLVSYVLFQSPVYAGILLAVGASYDQIVTAVASNAVVSCGMGVLYGYFLDMCRRWFRV 142 Vibrio parahaemolyticus
Q5E684           80 MKNIADLVAYVTFQSPAYAMILLVVGATPEQIITAVSSNVVVSCVMGVFYGYFLDACRKAFKV 142 Aliivibrio fischeri ES114
WP_025423488     80 TRNLADLLAYVSFQSPVYAVILLAVGVEWQQLIAAVASNAVASMVLGVVYGYFLEYCRRLFRV 142 Sodalis praecaptivus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap