Conserved Protein Domain Family
PerB

?
pfam06590: PerB 
PerB protein
This family consists of several PerB or BfpV proteins found specifically in Escherichia coli. PerB is thought to play a role in regulating the expression of BfpA.
Statistics
?
PSSM-Id: 115260
View PSSM: pfam06590
Aligned: 2 rows
Threshold Bit Score: 247.653
Threshold Setting Gi: 75411702
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9ETR8   1 MKNNLREEKEVVFDGCMNVLSLPSGWKAITPKKNNATSEIIVFFIPPKASYHIILKYNKTKHCELFFSDHITGEQDIIYS 80  Escherichia coli
Q9EUG4   1 MKNNLREEKEVVIDGCINVLSLPSEWKAITPKKNNVTSEIIVFFIPPKASYHIILKYDNTKHCELFFSDHITGEQDVIYS 80  Escherichia coli
Q9ETR8  81 QNAFFSHVINHIIALVDVLNKKSYASNVIKFLITMEGGGDILSESKRAP 129 Escherichia coli
Q9EUG4  81 QSAFFSHVINHIIALVDVLNKKSYASNVIKFLITMEGGGDILSESKRAP 129 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap