Conserved Protein Domain Family

pfam06585: JHBP 
Haemolymph juvenile hormone binding protein (JHBP)
This family consists of several insect-specific haemolymph juvenile hormone binding proteins (JHBP). Juvenile hormone regulates embryogenesis, maintains the status quo of larval development and stimulates reproductive maturation in the adult insect. JH is transported from the sites of its synthesis to target tissues by a haemolymph carrier called juvenile hormone-binding protein (JHBP). JHBP protects the JH molecules from hydrolysis by non-specific esterases present in the insect haemolymph. The crystal structure of the JHBP from Galleria mellonella shows an unusual fold consisting of a long alpha-helix wrapped in a much curved antiparallel beta-sheet. The folding pattern for this structure closely resembles that found in some tandem-repeat mammalian lipid-binding and bactericidal permeability-increasing proteins, with a similar organisation of the major cavity and a disulfide bond linking the long helix and the beta-sheet. It would appear that JHBP forms two cavities, only one of which, the one near the N- and C-termini, binds the hormone; binding induces a conformational change, of unknown significance. This family now includes DUF233, pfam03027.
PSSM-Id: 399529
Aligned: 232 rows
Threshold Bit Score: 111.916
Threshold Setting Gi: 195164770
Created: 21-May-2020
Updated: 7-Aug-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
ETN59354              9 ALMALTATGV------------N----EVAGQNii----lDAIMRRILENLRELMRTGN-PETGMPVLAPYNNPDLFIN- 66  Anophele...
Q29K83                9 VALLCCSLGS------------S-KL-----FDD--------QLRELTEFLRLQMRCGY-PPRGVPVLAPAQIAYQQVA- 60  Drosophi...
Q9V3H6                9 VALLCCSLGS---------AKL---------FDD--------ELRELTEFLRLQMRCGY-PARGVPILAPAQMAYKEIGi 61  fruit fly
EDV91489              9 TLLVAVASAT------------P-----VTQ--DtsmvgyREAMDMFLDAWKKMIPCGF-PSENIPVLAPLTTDFYAFN- 67  Drosophi...
EDX15174             12 LLALTVVNAN------------P-VVqQAASaq------fTSAVSRFLRAFKSIMPCGY-GDL--PVMSPIVSPFYEFE- 68  Drosophi...
O76879               80 GGhSesiKFKLTMSDAKLYNLaNS----MMVKSLKGFTKDltRPlkLTLLLDNPELEV-RAKYDVD--GKL----LIL-- 146 fruit fly
Q29K83               61 IAtEs-lGCRGNFTELTLEGL-DG----YEFAKLE--WNNilHT--IKFDINFPRVSVrSSKYMLDilARL----FGS-- 124 Drosophi...
Q9V3H6               62 RTen--fGCNGNFTDLIIEGL-DG----YEFSKLE--WNNilHT--IKFDMNFPKISLkSTNYKLNllARL----FGAd- 125 fruit fly
XP_551486            77 LSlGgllDFTAILRNLFVDGL-DRfqgtLTLNVMQ-------ME--FRYDFLFPDVVA-RGHYDAN--GRL----FGLi- 138 Anophele...
Q29K83              194 KDYLELLVNDNPAEVSQFMEGLIVP-PLNAVLENVAWYEITA 234 Drosophila pseudoobscura
EDV91489            201 NSFSLLFTEEIQPYVNPMLEKYLLP-TINNLLSNVDMTQLTN 241 Drosophila grimshawi
EDX15174            202 QSLLPLALEEIQPNITNILYQNFFVpKINDLLANVSMSELVS 243 Drosophila simulans
XP_551486           205 QDLIPSVLINFAPEVTDIISRVGIP-IADSVLNTMTLEDLFA 245 Anopheles gambiae str. PEST
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap