5UC0


Conserved Protein Domain Family
DUF1134

?
pfam06577: DUF1134 
Protein of unknown function (DUF1134)
This family consists of several hypothetical bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 399523
View PSSM: pfam06577
Aligned: 40 rows
Threshold Bit Score: 235.914
Threshold Setting Gi: 503064691
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5UC0_A           5 TYTAEEVVESGHRFFGSTSGGIASAVEKAFQSFG-LPNGYILGEEGSGAFIGGLTYGEGTLYTKN-AGDHKTFWQGPSLG 82 
Q0ATF1          41 SYSQDEIVDAVSDFFGVTAEAAASAMERVFSDLG-RPVGYIAGEEIAGAAGIGLRYGEGYLTLRGlGERQKVYWRGPSIG 119 Maricaulis ma...
zuci:PHZ_c2980  52 TYSQDEIVRGVSDFMGVTAETAGGVVEKLFANNG-RPTAYIAGEEGSGSFILGARYGRGLLYMKD-RQPMEVFWQGPSAG 129 Phenylobacter...
jgi:Caul_1182   43 TYSADEMIRNTSDFLGVGAETAGGVVERAFRDNG-QPTGYIAGEEGSGAIGLGLRYGRGLLYMKG-RETQEVFWQGPSIG 120 Caulobacter s...
WP_013480045    45 GYQRDEILRAGSDFLGVTVEALGGAIEKIFSDYGdRPTAYIAGEEVSGAIAVGLRYGKGLVHMKAlPSPQKIFWRGPSVG 124 Asticcacaulis...
jgi:Plav_2168   60 TYKEGEIVKEAGDFFGAVSKGLADAVNTVFERYG-EPNAYIKGEEASGAFVIGLRYGQGELVMKN-GTRQRVYWQGPSAG 137 Parvibaculum ...
WP_009553506    55 TYDQGTVMQAASEFFGNTTEGLARVIERAFAEQG-RPNGFIRGEEAALAISVGVRYGEGDLVLRD-GSSHKLYWSGPSVG 132 Burkholderial...
CAL92660        39 TYDKDSIIKDAAEFFGETTEGLAKVIEKAFNEQG-RPNGYIKGEEIAGAVGVGLRYGDGTLTLKK-GGSAKVYWQGPSIG 116 Azoarcus sp. ...
Q3JAI6          33 TYSEEAVLAAASEFFGETTKALARVIEKVFKEQG-RPNGYITGTEGSGAIGVGLRYGEGVLHTKS-GEEKKVYWQGPSVG 110 Nitrosococcus...
Q2NDX4         115 TYGEDDLIGAANSVFGDGAEGVAKMIQKLLADQG-EPNAYIVGREAGGAFIVGARYGSGKLFHKV-EGERPVYWTGPSIG 192 Erythrobacter...
5UC0_A          83 WDFGGQGSRVXXLVYNLDDIQHLYGRYAGVAGSAYVIAGVGFNVLKRENIVLVPIRTGIGARLGVNIGYLKLSAAPTWNP 162
Q0ATF1         120 FDAGGNASRVFVLVYNLDDVDRLYQRFPGVEGTAYFVAGLGVNYQRADDVTLAPIRSGVGLRAGANVGYLAYSRRRAWLP 199 Maricaulis ma...
zuci:PHZ_c2980 130 WDFGGNASRVFTLCYNLWEPEVIFQRFPGVEGSAYLVGGLGVNYQKAGGVTLAPIRAGVGLRLGANVGYLSYSRKRHVLP 209 Phenylobacter...
jgi:Caul_1182  121 WDWGGNASRVFTLCYNLQYPDAIFRRFPGVEGTAYLVGGLGVNYQRADDITLAPIRAGVGLRLGANVGYLAYSRQRNILP 200 Caulobacter s...
WP_013480045   125 FDTGGNASRVFSLVYGLYDVEKIYQRFPGVDGSAYFIGGLGVNYQQSDDTIVAPIRAGVGFRLGANIGYLAYSKTRKWFP 204 Asticcacaulis...
jgi:Plav_2168  138 WDFGGNAVKVFTLVYNLPNGETIYQRFPGVEGSAYLVGGIGINYQQRDDIVLAPMRSGVGLRLGASVGYLKYTKSREWLP 217 Parvibaculum ...
WP_009553506   133 VDLGANASKVFVLVYHLPDAQAIYKRFPGVDGSLYYVGGVGMNYQRLNGVVLAPIRLGVGLRAGASVGYVHYRREKSFNP 212 Burkholderial...
CAL92660       117 FDVGANASKVFILVYNLPRTQDIYQRFPGIDGSVYYVAGAGINYQQRDNIVLAPIRVGVGLRTGASVGYMHYTPTKTLNP 196 Azoarcus sp. ...
Q3JAI6         111 FDFGGNFSKVFTLVYHLKDMDALFQRIPGVDGSLYFIGGVSVNYQQTDDLILAPIRTGVGWRAGVSVGYVDYTHKKSWIP 190 Nitrosococcus...
Q2NDX4         193 FDAGANAGNTFVLVYNLYDSEELYERYPAGEGQAYVLGGLHASYMRKGDVVLIPIRVGAGLRLGVNAGYMKFSKKQRWLP 272 Erythrobacter...
5UC0_A         163 F 163
Q0ATF1         200 F 200 Maricaulis maris MCS10
zuci:PHZ_c2980 210 F 210 Phenylobacterium zucineum HLK1
jgi:Caul_1182  201 F 201 Caulobacter sp. K31
WP_013480045   205 g 205 Asticcacaulis excentricus
jgi:Plav_2168  218 F 218 Parvibaculum lavamentivorans DS-1
WP_009553506   213 L 213 Burkholderiales bacterium JOSHI_001
CAL92660       197 L 197 Azoarcus sp. BH72
Q3JAI6         191 F 191 Nitrosococcus oceani ATCC 19707
Q2NDX4         273 F 273 Erythrobacter litoralis HTCC2594
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap