Conserved Protein Domain Family
DUF1133

?
pfam06576: DUF1133 
Protein of unknown function (DUF1133)
This family consists of a number of hypothetical proteins from Escherichia coli O157:H7 and Salmonella typhi. The function of this family is unknown.
Statistics
?
PSSM-Id: 148278
View PSSM: pfam06576
Aligned: 4 rows
Threshold Bit Score: 331.867
Threshold Setting Gi: 82010391
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015959614   1 MINPSEVGKSGELVRLRTLESIWIQGKLRMWGRWSYIGGGSGGNMFNTLLASGKITKTAINEALRRMKKAGIKKPELEAF 80  Enterobacter sp...
Q57Q99         1 MINPSEVGKSGEMVRLRTLESIWIQGKLRMWGRWSYIGGGSGGNMFNQLLSSGKITKTAINDALRRIKKSGITKPELEAF 80  Salmonella ente...
Q0T554         1 MIYPTNTGKSGEHLRLTTLESVWIQGKLRMWGRWSYIGGGKTGNMFNQLLASKKLTKTAVNEALRRMKKAGIEKPELEAF 80  Shigella flexne...
EZE07629       1 MIYPEITGKSGEHLRLNTLEAVWIQGKLRMWGRWSYIGGGKSGNMFNRLLVSKKLTKTAVNEVLRSMKKSGLEKPELEAF 80  Escherichia col...
WP_015959614  81 FNEILNSKNKSGLAFCSDDEGLKIDGVIASVLMNddYRSLYGVIVDRHRLR-KSKLQMANELQAKHPDWTIITCRRRIDT 159 Enterobacter sp...
Q57Q99        81 LREILDSKNKSGLAFCSDEEGLKIDGVIGTTLVRegHSGLYSIIVNRYRLR-KSKRLMAEELQVKHPEWCYMTCRRRIDS 159 Salmonella ente...
Q0T554        81 LREMINGKQKTWLAHCTDAEALCIDRVISEVLAE--HPGLISVLRQRYEGRgMTKRKMAELLNDAHPKWSLRTCERRIEH 158 Shigella flexne...
EZE07629      81 FRDMTRGKQKSWLSHCTDTEALIIDRVISEVLGE--YPGLINILRQRYEGRgMSKRKMAECLNRTHPEWCFSTCEKRIAG 158 Escherichia col...
WP_015959614 160 WLSLAESILYVPICDAFG 177 Enterobacter sp. 638
Q57Q99       160 WLSLAESMLYAPMCDKFG 177 Salmonella enterica
Q0T554       159 WLKVAEFILYKPMVMAFG 176 Shigella flexneri 5 str. 8401
EZE07629     159 WLAVAEHMLYVPMHDSFR 176 Escherichia coli O69:H11 str. 08-4661
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap