Conserved Protein Domain Family

pfam06573: Churchill 
Churchill protein
This family consists of several eukaryotic Churchill proteins. This protein contains a novel zinc binding region that mediates FGF signaling during neural development (unpublished obs Sheng G and Stern C).
PSSM-Id: 429010
Aligned: 13 rows
Threshold Bit Score: 174.868
Threshold Setting Gi: 321461974
Created: 27-Apr-2021
Updated: 29-Sep-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
KJE95266      81 DGYQEYTMECQLCGTADDTASVLPDDPRKAQ 111 Capsaspora owczarzaki ATCC 30864
EFX73001      78 GDYQEYEMDCALCGTAEDSISILPDDPRKAS 108 common water flea
XP_002610724  79 DGYQEYQMTCLLCGSGEDSISILPDDPRKEM 109 Florida lancelet
XP_002115762  80 EGYQIYGMECLLCGCGEATVSVMPNDPRKll 110 Trichoplax adhaerens
XP_003386737  96 EEFQEYSMNCALCGYGSDTVSILPDDPREKq 126 Amphimedon queenslandica
ABN70841      79 GDSQDYSMSCLLCGEGTDQRNIFPENQYRQN 109 starlet sea anemone
XP_003726593  80 GEYQEYAMYCMLCGVGSDTVSVLPVDPRKEM 110 purple sea urchin
Q4T7L7        79 DEYQEYTMLCLLCGKAEDSISVLPDDPRQSA 109 spotted green pufferfish
XP_012404211  79 DEYQEYTMLCLLCGKAEDSISVLPDDPRQMA 109 Tasmanian devil
Q66JD9        79 DDYQEYTMLCMLCGRAEDSVSVLPDDPRQMA 109 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap