Conserved Protein Domain Family
Neural_ProG_Cyt

?
pfam06567: Neural_ProG_Cyt 
Neural chondroitin sulphate proteoglycan cytoplasmic domain
This family represents the C-terminal cytoplasmic domain of vertebrate neural chondroitin sulphate proteoglycans that contain EGF modules. Evidence has been accumulated to support the idea that neural proteoglycans are involved in various cellular events including mitogenesis, differentiation, axonal outgrowth and synaptogenesis. This domain contains a number of potential sites of phosphorylation by protein kinase C.
Statistics
?
PSSM-Id: 368979
View PSSM: pfam06567
Aligned: 4 rows
Threshold Bit Score: 195.588
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_022060673 409 LHVLKTENKKLRKRSKYRPSSEQHNDNFSLSTIAEGSHPNVRKLCDT----PPNV-PHARALAYYDNIICQDDPNSQNKL 483 spiny chromis
Q71M36       447 LYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPNVRKFCDT----PRVSsPHARALAHYDNIVCQDDPSAPHKI 522 house mouse
1_pfamImport   1 LYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPNVRKLRHSlyllPTMLaPWLSVITYLSGVLRQDDPSASHKI 80 
NP_001038357 363 LHVLKTENRRLRKHSKYRPKSEQHIDNFSLSTVAEGSQANVRKLCDT----PTNL-PHARALAYYDNIVCQDDTSK---- 433 zebrafish
XP_022060673 484 EDPVKAPPKEDDSLNIHNSLTPKHENHKvlGEENSSEVNSLQNNM 528 spiny chromis
Q71M36       523 QDPLKSRLKEEESFNIQNSMSPKLEGGK--GDQDDLGVNCLQNNL 565 house mouse
1_pfamImport  81 QEVLKSCLKEEESFNIQNSMSPKLEGGK--GDQADLEVNCLQNNL 123
NP_001038357 434 EEPCKCPPKEDESLNNQNSVTPKLENDKpaTEDNAEEVNSPQNNV 478 zebrafish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap