Conserved Protein Domain Family
CBP_BcsQ

?
pfam06564: CBP_BcsQ 
Cellulose biosynthesis protein BcsQ
This is a family of bacterial proteins involved in cellulose biosynthesis. (Roemling U. and Galperin M.Y. "Bacterial cellulose biosynthesis. Diversity of operons and subunits" (manuscript in preparation)). A second component of the extracellular matrix of the multicellular morphotype (rdar) of Salmonella typhimurium and Escherichia coli is cellulose. The family does contain a P-loop sequence motif suggesting a nucleotide binding function, but this has not been confirmed.
Statistics
?
PSSM-Id: 399515
View PSSM: pfam06564
Aligned: 11 rows
Threshold Bit Score: 294.262
Threshold Setting Gi: 81441065
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6CYY4            1 MPVIALQGIRGGVGTTSIAAALGWAFQRLGESALVIDFSPDNLLRINFNMPFEQRRGWARAEADGAPWQTGAMQYIPGLD 80  Pectobacteri...
WP_013204395      1 MPVIAFQGLRGGAGTTSLVAGLSWALHTLGESVIAIDMSPDNQLRMHFNTASDHPRGWLRTALDRQPWQQSALRYAPELD 80  Erwinia bill...
AHG20398          1 MSVIALQGVRGGTGTTSLLAALAWALQELGEPVLAIDFSPDNLLCLHFNTPFEQTRGWARAESDGAHWQQGAMRYCKNLD 80  Chania multi...
WP_002921510      1 MAILGLQGVRGGTGVTSITAALAWALQLLGESVLAIDASPDNMLRFFFNTDIHHQDGWARALLDGRDWRDAGLRYTQHID 80  Enterobacter...
P37655            1 M--------RGGVGTTTITAALAWSLQMLGENVLVVDACPDNLLRLSFNVDFTHRQGWARAMLDGQDWRDAGLRYTSQLD 72  Escherichia ...
wugsc:CKO_04978   1 MSILGLQGVRGGVGTTSITSALAWALQILGENVLVVDASPDNLLRMSFNVDFAHRDGWARALLDGKDWRDAGLRYTTQLD 80  Citrobacter ...
CAR44192          1 MPLIVLKGLRGGVGTTSITVALARQFHHHKYNVIVIDNCVNNILHFYFPEK-SQVTTLGQALLAHTPIEQAICDYQNGYQ 79  Proteus mira...
Q88JL5            1 MTSLALHGVRGGLGRSALLAALGYALQGVGERVLLIDLCPSNLLGLHFNLPLDTSEGWALAEREGRPFSDAVYEVLDGLC 80  Pseudomonas ...
WP_011911520      1 MKQLVLRGLRGGIGATSLLAGLGIALHEQGERVLLIDLSPDNMLRLHFSVDIAYASGWARAQLDAAPWHESALELLPGLH 80  Pseudomonas ...
WP_043684971      1 MNILTLTGVRGGEGTTTVAGMLGDALHALGQRVLLVDLNASDLLRLHFGVPHRDGHGWVAAGFP-FEWRQQAFELAPGLA 79  Castellaniel...
IBRC:GU3_14415    1 MKLVCVSGIRGGTGSTTMLAALAHALHRLEQRVLLVDLSSANMLGLHFEQPISRRQGWARTHVESADWRAQAVELQPGLC 80  Oceanimonas ...
Q6CYY4           81 FLPFGRLNTQEVAT-LQQhYQQHPAIWQNNLTKLSaaGRHRWVLIDVPA---GNSPLTRQALATANTVFQVVVADANCHS 156 Pectobacteri...
WP_013204395     81 FIPFGQLNDDELMAfVSQ-PQAGLDGWTAQLATLR--QTYRWILLDVPA---GTTPWTRALLALADRTISVMVPDANCHI 154 Erwinia bill...
AHG20398         81 FLPFGRLNLAEQLN-LQQqCLENPGRWRDFLKQIKasKQYRWILLDIPA---GNNPLQQQQLALADSILLVINPDANCHA 156 Chania multi...
WP_002921510     81 LLPFGQLSAGEREN-VDQ-LQPTLGAIAEAVQQLQ--GQYRWLLLDLPA---GYSPLTRELLTLCDRSLVVVHPDANSHI 153 Enterobacter...
P37655           73 LLPFGQLSIEEQEN-PQH-WQTRLSDICSGLQQLKasGRYQWILIDLPR---DASQITHQLLSLCDHSLAIVNVDANCHI 147 Escherichia ...
wugsc:CKO_04978  81 LLPFGQLTVEEREN-PQE-WAEKLGAICAGLRELKesRRYSWILLDLPH---GVSPLTQQLVSLCDHTLAVVKADTNCHI 155 Citrobacter ...
CAR44192         80 ILPFGVVNSEDKLH-LQA-SATANQHLLHFFTAFTqqYPDTLIFLDLQP---EHDTLFKSWVAKANIVLTVTTPESNCHI 154 Proteus mira...
Q88JL5           81 LLPYGNLPGGAQH------RVPDAQSWPARQVELA--EHFDWLLYDLPQ---LPGDTTGNGIE-TDVRVLVAEAEMASHL 148 Pseudomonas ...
WP_011911520     81 LLPYGELGGAEISQ-IEGqLCADSSCWAQRCDLIG--HNYDWVLFDLPQrlpGHRAVVSEANR-ADVLIDLATPDPGCHV 156 Pseudomonas ...
WP_043684971     80 LVPFGRAAVEDTG--MSP-LLHGDDFWLRALPGLA--GDFDWVLFDCPA---YPGRQARALRFRSTLDVLVAQPDVAAHV 151 Castellaniel...
IBRC:GU3_14415   81 LLPYGHTSVQERER-LALwLRNHPGEWNRRMNRLL--AGFDWVLFDSPH---DALAQTRSLQP--DLSIQVVNADAACHV 152 Oceanimonas ...
Q6CYY4          157 RLHQQALPRQCHFLVNQFSTLSTLQQDLHQLWL-HTL-SHLLPL-VVHRDEALSESLMLKQPLGECRPDSVAAEEIMTLA 233 Pectobacteri...
WP_013204395    155 RLHQQRFTANNLFLLNQFFPVSRSQQDLHQLWL-ATL-QNLIPL-TLHRDEAVAEALLRKQPFSEYRPQSLAAEEMMTFA 231 Erwinia bill...
AHG20398        157 RLHQQSLPTPCHFLINYYSAASQLQEDLHQWWL-QTL-GGLLPL-IVHRDEALAEALAAKQPLGEYRPESLAAEEVLTLA 233 Chania multi...
WP_002921510    154 RLHQQPLPANGDILINDLRVGSQLQEDLYQLWL-ESQ-PRILPV-TIHRDEAMAECLAAKQPLGEYRQDSLAAEEVLTLA 230 Enterobacter...
P37655          148 RLHQQALPDGAHILINDFRIGSQVQDDIYQLWL-QSQ-RRLLPM-LIHRDEAMAECLAAKQPVGEYRSDALAAEEILTLA 224 Escherichia ...
wugsc:CKO_04978 156 RLHQQALPTGAHILINDLRIASQLQDDLYQVWL-QSQ-RRLLPM-VIHRDEAMAECMASKQPLGEYRGDSLAAEEVLTLA 232 Citrobacter ...
CAR44192        155 RLNQHTFAANEYILVNQFCATSQIHQDFYQFWQ-TSQ-FPFCPI-KLHRDEALLEACASRLPLYDYRANCMLVEEINQLL 231 Proteus mira...
Q88JL5          149 LLGRRPLEHFDMLLVNRYDPASRLQSDLLMVWR-DLF-RDRLPIqVVHRDEAFLEALAYKAPLGLYAPQSLACRDVQSLA 226 Pseudomonas ...
WP_011911520    157 LLQQRPRPDADLLLINRFNPASQLQRDLLLLWRsQPR-GNRQPQ-LIHEDEALPEALAHKLPIGHYAPKSQAASDLRSLA 234 Pseudomonas ...
WP_043684971    152 LLAQIGLGAASHLLINDFEPSWPLACDVVLDWR-HHYgPRLLPQ-AIRRDACLPEALACKQPVTRYRPDAAASRAARVLA 229 Castellaniel...
IBRC:GU3_14415  153 LLQAQ--PSRHWLLVNRFDPASRLQQDVLLLWRqQFA-DRLLPL-TMHRDEATAEALAHKLPLGAYAPQSQNAITADSLA 228 Oceanimonas ...
Q6CYY4          234 NWCL 237 Pectobacterium atrosepticum
WP_013204395    232 SWAL 235 Erwinia billingiae
AHG20398        234 NWCL 237 Chania multitudinisentens RB-25
WP_002921510    231 NWCL 234 Enterobacteriaceae
P37655          225 NWCL 228 Escherichia coli K-12
wugsc:CKO_04978 233 NWCL 236 Citrobacter koseri ATCC BAA-895
CAR44192        232 QWCL 235 Proteus mirabilis HI4320
Q88JL5          227 VRCL 230 Pseudomonas putida KT2440
WP_011911520    235 LWCL 238 Pseudomonas stutzeri
WP_043684971    230 QWCL 233 Castellaniella defragrans
IBRC:GU3_14415  229 AWCM 232 Oceanimonas sp. GK1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap