Conserved Protein Domain Family
DCD

?
pfam06559: DCD 
2'-deoxycytidine 5'-triphosphate deaminase (DCD)
This family consists of several bacterial 2'-deoxycytidine 5'-triphosphate deaminase proteins (EC:3.5.4.13).
Statistics
?
PSSM-Id: 399514
View PSSM: pfam06559
Aligned: 36 rows
Threshold Bit Score: 533.725
Threshold Setting Gi: 504774579
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013250079                      7 SKGILPYQHITQLIARRSI-TSEHPIED-----RQIQPASLDLRLGKKAYRLISSFLP-ELSAISSRLnvldfyqSD--L 77  Nitrospira defluvii...
dbos:SAR116_1881                  8 NDGILPVQALRAAADAGIIlSGDNDFID-----GQLQPASLDLRLGAEAWRVQASFLPgADSTVAQKL-------DK--F 73  Candidatus Puniceispirillum marinum IMCC1322...
Q0BYT8                            1 mSGVIPDFEIEALLQSGAI-RCDEAPEP-----GQIQPASLDLRLAVDAYRLRASFLPgKDRTVAEML-------QEpgI 67  Hyphomonas neptunium ATCC 15444...
jgi:Hbal_0350                    10 PIGVLPDTQIQSLCDSEVI-SSVDGLAN-----DQVQPASIDLRLGKTAYRMRASFLPgLGKKVSDYFn------DD--L 75  Hirschia baltica ATCC 49814...
Q0ASF2                            3 DTGILPDHHLAALAGRGIL-TTAAPLAD-----GQVQPASIDLRLGSKAWRLRASFLPgPGRTVAERLd------DD--L 68  Maricaulis maris MCS10...
dbos:1099484000100_PB2503_02827  11 PLGVFAEDDLAALVAAETI-TLSAQCGE-----CQIQPASFDLTLGQRAWRIRAAFLPgPARSVKSCL-------DEg-L 76  Parvularcula bermudensis HTCC2503...
WP_012285709                      6 AAGILPCQSIEDLIAQEAI-TSQTPFDT-----DQVQPASLDLRLGARCWRVRASFLPgVARRVPERL-------KD--V 70  Caulobacter sp. K31...
WP_013268044                      7 VPGILPCQSIEALIAGGAI-TSATPFDA-----DQVQPASLDLRLSDRAWRVRASFLPgQ-RLVADRI-------AD--V 70  Brevundimonas subvibrioides...
WP_014961681                      1 -mGTLSDVQISRLIDAGAI---VDPFEGrdallSRVQPASLDLALGQTAYRIRSSFLP-QGDSVSRLL-------PE--L 66  Leptospirillum ferriphilum...
WP_016482024                      8 NNGVFPAQWIRQAFEKGWI-DAEEPLRS-----GQIQPNSLDLRLGTVGYRVQCSFLPg-EEGMAQKL-------AR--F 71  Chthonomonas calidirosea...
WP_013250079                     78 VMYEMDLT-QGAILEKGHVYLVPLLEQLDLPATLRARANPKSTTGRLDVFTRVVTDLNAGFDEIRAGYRGPLYLEVVPRS 156 Nitrospira defluvii...
dbos:SAR116_1881                 74 AMHKIDLS-AGAVLERGCVYIVKLQESLALSADLSAMANPKSSTGRLDIFTRLITDNALEFETVSKGYHGPLYAEISPRT 152 Candidatus Puniceispirillum marinum IMCC1322...
Q0BYT8                           68 HLHRVDLTqEGAVLETGCVYLVPLQESLRLPAGLSARANPKSSTGRIDVFTRLVTNRSRAFDEVPMGYSGPLYLEVSPRT 147 Hyphomonas neptunium ATCC 15444...
jgi:Hbal_0350                    76 VMHELDLT-KGTVLETGCVYLVPLKEVLNLPEGLSGAANPKSSTGRIDVFVRMITDGSDRFDAARAGYSGPLYVEISPRT 154 Hirschia baltica ATCC 49814...
Q0ASF2                           69 VMHTVDLT-AGAVLETGCVYLAPLQEGLKLPAGLSAAMNPKSSTGRIDVFTRVITDHGVAFDQAPVGYEGPLYAEISPCT 147 Maricaulis maris MCS10...
dbos:1099484000100_PB2503_02827  77 GLHVLDLT-DGAVLETGCVYLVELREGLALPPTLSARANPKSSTGRIDVFVRLVTDDGTAYDEVPAGYTGPLYAEVSPRT 155 Parvularcula bermudensis HTCC2503...
WP_012285709                     71 AMHELDLT-KGAVLEKGCVYIAEIQERLALPGNIAARGNPKSSTGRVDVFVRLLSDHSKAFDDIEAGYEGPLYIEIAPQT 149 Caulobacter sp. K31...
WP_013268044                     71 SMHSIDLS-GGYVLEKGCVYIAELQERLSLPKGLIARANPKSSTGRVDVFVRLLTDRGGSFDDVDEGYEGPLYLEIAPQT 149 Brevundimonas subvibrioides...
WP_014961681                     67 SLYPVDLS-THPYLEKGAVYLIPLSEQLSLPPGVEGKTNPKSSTGRVDVFTRVLTEKTHRFDDIPPGYKGHLYLEVFSRS 145 Leptospirillum ferriphilum...
WP_016482024                     72 GWYRFCLPeEGVVLERNQVYIFPLMERLALPQNVRGRANPKSTTGRLDVFCRLVTEHGVAFDETPQGYQGPLYLEVVPRS 151 Chthonomonas calidirosea...
WP_013250079                    157 FAIKVRTGDSLNQIRFVRGDATVSDSALQKLHGTDPLLFHNaSPPkaLpqkefrtDRGLFLRIDL---TGsAREDAVIGY 233 Nitrospira defluvii...
dbos:SAR116_1881                153 FSVLVRAGSRLSQLRLRRGEPHISDDMMQDLQRKVGLVHGTdAPD--I-------RDGIALSVNL---AP-DTQSGMIGW 219 Candidatus Puniceispirillum marinum IMCC1322...
Q0BYT8                          148 FPIKVRPGDRLAQLRFKKKKPETLREKV--------------------------------VSIDL----E-PPAGQPAGY 190 Hyphomonas neptunium ATCC 15444...
jgi:Hbal_0350                   155 FSILAREGDRLLQLRLRNGEQKTIRDEI--------------------------------FSIDL----K-PGNDDIAGY 197 Hirschia baltica ATCC 49814...
Q0ASF2                          148 FSILAREGDRLSQVRFRQGAHKALRE--------------------------------VTVSVDLagfGD-----GIVGY 190 Maricaulis maris MCS10...
dbos:1099484000100_PB2503_02827 156 FSIVVRPGSSLNQLRIRHGETRLSDEALGERARREDLTGPRhHGH--I-------HQGLCVSVDL---SG--DLGPVAAW 221 Parvularcula bermudensis HTCC2503...
WP_012285709                    150 FSVLVRSGTRLNQLRLKRGEPVKLATR--------------------------------SVGVDL--------TTGIVGF 189 Caulobacter sp. K31...
WP_013268044                    150 FSILVRPGTRLNQLRLKAGEPPKLETR--------------------------------SVGVDL-------QGGDIVGF 190 Brevundimonas subvibrioides...
WP_014961681                    146 FPLKVKPGLSLSQLRLFENRKILTDLELMNRHRTFPLFWYDgKHKeeTee----fRDGVSLGVDL-------SFESIVGY 214 Leptospirillum ferriphilum...
WP_016482024                    152 FAIRVRAGDALAQIRFQTGEPRLSAEETRALLDEVPIILSS--ELlpLrsrdlaiSNGILLSIYLprySG-QGRQATIGY 228 Chthonomonas calidirosea...
WP_013250079                    234 RAKKNSHVIDLAKIGHYAALDFWEPLKRHrQDS--LLLEPEEFYILASKERIRVPPGYAAEMVAYEAACGELRTHYAGFF 311 Nitrospira defluvii...
dbos:SAR116_1881                220 RARKHAGLIDIDAPASVSVNEFWEQLTPDdLTAggLVLNPDEFYILASREFVTVPKDHAAEMRAYDTRVGEFRAHYAGFF 299 Candidatus Puniceispirillum marinum IMCC1322...
Q0BYT8                          191 RAKAHSGVVDLRGLGAHEVSQFWEPVYPKsGR---IVLNPEEFYILVSRETVKVAANEAAEMAAIAPELGEFRAHYAGFF 267 Hyphomonas neptunium ATCC 15444...
jgi:Hbal_0350                   198 RAKRHSRVLDLKNINGHKIEDFWEPVRPYnGA---LVLDPGEFYILASKEKVVIPVDEAAEMAPIAPEFGEFRAHYAGFF 274 Hirschia baltica ATCC 49814...
Q0ASF2                          191 RARRHSGLVDLSRIGGHAAGRYWEPLTAPdRR---LVLDPGEFYILASREAVTIGCDEAAEMAPIATEIGEFRAHYAGFF 267 Maricaulis maris MCS10...
dbos:1099484000100_PB2503_02827 222 RAKKHTGLIDVDRVAALRPEAYFDPLPVMqDQF--LILDPGEFYILASQEELRLPDDLAAEMAPIDADLGAFRVHYAGFF 299 Parvularcula bermudensis HTCC2503...
WP_012285709                    190 RGRRHAGVIDLDHEDGHDPRDFWEPLETRhGE---LLLDPGEFYILASKDNIEIPVLEAAEMTPIDPSVGEFRVHYAGFF 266 Caulobacter sp. K31...
WP_013268044                    191 RGRRHAGVVDLDKIDGHDPKDFWEPLSLRrGE---LLLDPGEFYILASNEAVEIPVMQAAEMTPIDPSVGEFRVHYAGFF 267 Brevundimonas subvibrioides...
WP_014961681                    215 KARPNTRVLDLTVSSENPAEPFWEPIMRPsSGD--LILEPESFYLFASRAKIRIPSDMAGEMVEFDAQSGELRTHYAGFF 292 Leptospirillum ferriphilum...
WP_016482024                    229 QARKNTPPIDLRAIGQARKRHYWDRLYADgKP---IILEPDEFYIFRSRELVCLPPTICAEMVAFDAGSGELRTHYAGFF 305 Chthonomonas calidirosea...
WP_013250079                    312 DPGFGYGD---GKMRGTQVVLEVRPHDVPFLIHDGQTFFKVVYDRMLTVPTQVYGTALG-SSYQRQA-LTLSKHFK 382 ...
dbos:SAR116_1881                300 DPGFGVAE---IGATPTRAVLEVRSHDVPFLIEQDQTVCRLVYEPMSAIPETLYGSGGSgSNYQSQG-LRLAKHFi 371 ...
Q0BYT8                          268 DPGFGTNK---A---GSRAVLEVRSRDVPFILEHGQPVAKLIYEPMTEKPRHLYG-GQG-SNYQGQG-LKLSKHFA 334 ...
jgi:Hbal_0350                   275 DPGFG------VEGLEGKAVLEVRSREVPFILTDGQPMGRLVFEPMVANPKVPYGAAGSfSNYQGQG-LKLSKHFg 343 ...
Q0ASF2                          268 DPGFGTTE---AGGTGARAVLEVRGRDVPFLLEHGQPIARLVYEPMLDVPHTVYGQ-VA-SNYQAQG-LKLSKFFA 337 ...
dbos:1099484000100_PB2503_02827 300 DPGFGLEA---P----SRAVLEVRGYDAPFLIRHGQTMARLTFERLTRPVSRRYGEALK-SHYHGQG-LRLSKHFA 366 ...
WP_012285709                    267 DPGFGTEE---AGAVGSKGVLEVRSHETPFLLEDGQIVARLVYEPLTARPDRLYGEG-G-SHYQRQG-LKLSKHFK 336 ...
WP_013268044                    268 DPGFGTDE---AHGAGSKGVLEVRTHDTPFLLEHGQIVARLVYEPLTERPTRLYGEG-G-SHYQRQG-LKLSKHFR 337 ...
WP_014961681                    293 DPGFGLVE---E---GARAVLEIRPHDVPFRVVDGQKIFRLRFEWMESPPRHPYGLEIG-SNYSRQA-LKLSKYFg 360 ...
WP_016482024                    306 DSGFGYAAalpATETAAAVVLEVRSRDVPFLIEDGQPLFRIHLLRCTEEPEFLYGAQAG-SSYQSQRdVRLSKQFT 380 ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap