3CLQ


Conserved Protein Domain Family
DUF1116

?
pfam06545: DUF1116 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1116)
This family contains hypothetical bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 399507
Aligned: 54 rows
Threshold Bit Score: 202.796
Threshold Setting Gi: 501061757
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3CLQ_A              91 ITFSPCHEHDAVGSXAGVTSPNXYVHIIKNETY-GNTAFTNLSEQ--LAKVLRFGANDQSVVDRLIWXRDVLGPLLHDAX 167 Enterococ...
WP_013678263       143 ITLDAANHHDAVVPMASAVGPSQPALVVDNREG-GTRAFSSLNQG--PGEVAWFGRDTDAAIARLRFLADTAGPAIAQIL 219 Pseudonoc...
WP_014199608        82 VTLRPAQDFGVVTPLAAVVSRSMWLHVVVDAGGsGARAYSPLNEG--GGPALRFGIVSGAVVERLRLLHGAVGPALAGI- 158 Azospiril...
zhongguo:B5T_04404  85 VRLLPAQDFSVVTPLAAVISPSTALVEISDAVEpGHRCWSLLGSG--SGPQIRFGSRDPAILERLRWRDQVLAPALRKVL 162 Alcanivor...
Q13LZ1              83 VRLESAQSYGVVTPLAAVISPRAMLVEVSDANDqTSRAWSLLGSG--AGPQIRFGGRDRRIIERLKWRDEVLAPALSGAL 160 Paraburkh...
jgi:Bphy_4551       84 VRLECAQSYGVVTPLAAVVSPRTMLVEVADANHpDARAWSLLGSG--AGPQIRFGSRDIRILERMKWRDCVLAPALDQAL 161 Paraburkh...
WP_015477620        88 VRLYPAQDHGCAIPLADVLSPSMQVLVIEDGDCpSRRSFSTLNGG--DGPVMRIGQYGENVLQRLRWINQHLAPRLQTVI 165 Pseudomon...
WP_012113071        90 IRLAPAQDHGVMVPLAAVFSPNMAAQIVVDLADpRRRVLAPINGG--MAKAQRLGLAGPDILAHLKWINGNLAATLSIVA 167 Xanthobac...
dbos:SAR116_1713    95 IELRPAQDYGVVTPLAGVVTPHMPLHYVYDGNHgRTVCLTPINGG--NGAAMRLGQCSDAAVAHMRWINGPVLDCLAAGL 172 Candidatu...
CCX92898            88 IKISSALDHNTVGAGTGIITKSVVLNVVEDRHN-HTVAATFPAEGpfQGGFCGWGLYSKEIAENLRYMREELFPPMVEAL 166 Firmicute...
3CLQ_A             168 TfCPEGIDLRLXLSQALHXGDECHNRNVAGSTLLVQA-LTPYXVQTDFSREQLKEVFEFLGSSDYFSGPTWXGAAKCALD 246 Enterococ...
WP_013678263       220 A-EAGQLDILAIAAQGITMGDDLHMRTQAATNLLTRTwLAPIAALPDAA---RVPFAQYLAGNHLFFLNFAMAAAKSLQL 295 Pseudonoc...
WP_014199608       159 ----GPVELRGIACEAMEQGDELHGRVGVASALLTET-LVSRLGG-------TGAVCAFLKEAGQFFLNPWMAACKAVML 226 Azospiril...
zhongguo:B5T_04404 163 A-T-RPIALLPLARLGLEAGDDLHAQTTHANQALCAA-MPSTL---------PEEVRECLRNTPLFFLTLWMGACHLMLA 230 Alcanivor...
Q13LZ1             161 A-Q-GPIDLFPLAQTGIDGGDDLHARTTSATAALRTL-LAPRVDHVDID--------GMLAQTPLFFLTLWMAACKLMLS 229 Paraburkh...
jgi:Bphy_4551      162 A-Q-GPIDLLALARTGFDDGDDLHARTSGATAALRAL-LAQRRDHADVD--------AMLAQTPLFFLTLWMAACALMLS 230 Paraburkh...
WP_015477620       166 A-R-QPMDVLPVADAALAAGDDCHGRTQQGSQLVAKA-LLEQASPGDFD----DDIRRFLEQSAAFFLNLWMAAVKCCLL 238 Pseudomon...
WP_012113071       168 D---RDIPLLPIADAALAAGDDCHGRTVAGTRLVIEA-IAPRLGSDTLE-------RHFLDGAPGFFLNLWMAAAKLIAS 236 Xanthobac...
dbos:SAR116_1713   173 G---EGLELIPFASAGLAEGDDCHGRTIAATQFLVNE-IDSRSKGGIAN----EEVRAFLNQSPSMFLNLWMAASKCIMM 244 Candidatu...
CCX92898           167 H-KLGGIPIKPILAESMQMGDENHTRQTACDYIYDRL-MLPALFELDRPKKEIMKTVRYIVDTPRFFHCYGQAAARAALV 244 Firmicute...
3CLQ_A             247 AGH---NVENSTIVTTXCRNGVEFGIRVSGIGgNHWFTGPAQR-VIGPXF-AGYTQEDAGLDXGDS 307 Enterococcus faecalis V583
WP_013678263       296 WAH---QVAGSSIVTHMARNGTTFGVKVAGD--DSWYITEAPPvGDAMYY-SGYGPETSAKDIGDS 355 Pseudonocardia dioxaniv...
WP_014199608       227 AGD---GVPGAALVTAAGGNGVRFGLRLSGMMgEGWASAPVAA-PQGPDI---GAPRPRLPAIGDS 285 Azospirillum brasilense
zhongguo:B5T_04404 231 AAA---GETGSSLVLALTGNGRRVGIRIADEP-ALWRTHTAPV-PEGPRI--SASVVPASPMVGDS 289 Alcanivorax dieselolei B5
Q13LZ1             230 AASasaSASASTLVVALAGNGERVGIRLAGSP-SRWFTAEAGA-PRGPRL-DPQQHAIAARLTGDS 292 Paraburkholderia xenovo...
jgi:Bphy_4551      231 AASr-gSPSASTLVVALAGNGERVGIRLAGAP-SRWLVAAAHA-PEGPRL-DPQQQTAAAPLTGDS 292 Paraburkholderia phymat...
WP_015477620       239 AAE---DVPGSSVVTAAGGNGEQFGIQVSAMP-GRWFAVAAQA-PRVPGA-DEQTRQRALGAIGDS 298 Pseudomonas sp. ATCC 13867
WP_012113071       237 AAE----IPGSSLITAMGANGVDAGVQLGGRP-GQWFTAPAAP-PEGTLV-EGVTPDDRLGAIGDS 295 Xanthobacter autotrophicus
dbos:SAR116_1713   245 AAT---GIDGSSMITAMGSNGVDVGLQVAGLP-GLWFTAPAAP-PNGHIT-DGLDETRKLGAIGDS 304 Candidatus Puniceispiri...
CCX92898           245 AAD---GTEYSTMVTAVCGNGVEFGIKIASLP-GQWFTAPAPM-MKGRYTsSEFTEKDQLPWMGDS 305 Firmicutes bacterium CA...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap