Conserved Protein Domain Family
DHOR

?
pfam06537: DHOR 
Di-haem oxidoreductase, putative peroxidase
DHOR is a family of di-haem oxidoredictases. It carries the two characteristic Cys-X-Y-Cys-His haem-binding motifs. The C-terminal high-potential site functions as an electron transfer centre, and the N-terminal low-potential site corresponds to the peroxidatic centre. Its probable function is as a peroxidase.
Statistics
?
PSSM-Id: 399503
View PSSM: pfam06537
Aligned: 6 rows
Threshold Bit Score: 678.489
Threshold Setting Gi: 503142885
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Shew_0677    45 YTQVTALGGDTTT--FDASSSGHGYSTPALNLNQTQLAQHLSGDLNFETAFTTAPNEEH------PELDGLGPVFNNADC 116 Shewanella l...
Q12RB3           50 YTDVTASGGATTT--FDAGNSGHGFSTPAPNLGAAELAQHLEGDANFEMSFTTAPNAAH------PELDGLGPVFNNADC 121 Shewanella d...
Q488R9           44 YTHISQLGGDATA--VSASDSGHGFSTPMPNLTTEQLTKHLAGDAHFETAFTTAPNSEH------PELDGLGPVFNNQDC 115 Colwellia ps...
WP_013377546    229 LPQEAWLGGRTTVsyNYSNEPVHLFKQMATNLAPVNAQPFVEGRRLHHTDFGTGAHSESgnpvftAQQNKLGPAYIARSC 308 Stigmatella ...
OUHSC:BDW_01985  28 YTNVLKLGGDTTI--HIQGESVRAYRNPAANLTEEQVAAHLAGDALFERNFSDNPTRP---------LKGLGPVYNNTSC 96  Bdellovibrio...
Q6MQA2           27 YVHAEKSGGETTV--FFKGQSIWAFRNPAANLSEEEIARHLTGDALFERNFSDDPNRF---------EYGLGPVHNNTSC 95  Bdellovibrio...
jgi:Shew_0677   117 NSCHQRDGRNSTPIVPAGQTRIKLGSEAGIF------------------------------------------------- 147 Shewanella l...
Q12RB3          122 NSCHQRDGRNSTPSLGADKTRVKLGTDAGIF------------------------------------------------- 152 Shewanella d...
Q488R9          116 NSCHQRDGRSSTITLAQGQERVLLGSEAGIF------------------------------------------------- 146 Colwellia ps...
WP_013377546    309 ISCHPHNGRSLPPDMGPSERDVQFHVNNAPWadlhytvngggqqsfrmphdngtnnntqvvkglpggaavqyhftignas 388 Stigmatella ...
OUHSC:BDW_01985  97 IACHAKDGRGALPVVPVNQEWVPFKQNESIF------------------------------------------------- 127 Bdellovibrio...
Q6MQA2           96 NACHAKDGRGALPVVPFNKEWVPLRQNEAVF------------------------------------------------- 126 Bdellovibrio...
jgi:Shew_0677   148 --LRISKAPDQPCL--QGTAANNYCAPIPVPNF----------GTQLFHRGVLKAREDWQQNLFGGQADVYL-SYELKTV 212 Shewanella l...
Q12RB3          153 --LRISKAPNQACT--QGSAENNYCAPIPVPDF----------GGQLFHRGVLKARADWQDHNFGGQADVYL-SYERTTV 217 Shewanella d...
Q488R9          147 --LRMS-IDDGECS--NPSADNNYCKNAGVDGF----------GTQLFHRGVLKARDDWQENPFIGQADVYL-AYEYSTV 210 Colwellia ps...
WP_013377546    389 ggLSTTTPVQFTVSdgNSSGSSSYGYTVLSPPLlytvkvgqvsGTTVTAHPQLGWILQPQSTSGSAEGAVRIsSWTATSG 468 Stigmatella ...
OUHSC:BDW_01985 128 --LRIS-IENSHIKntPKSAMNSWGAPVPVPGF----------SDQLFHLGSYGVRED---APGVGQARVWM-KYEHSEF 190 Bdellovibrio...
Q6MQA2          127 --LRIS-IEDGVKK--PKTKENKFGAPVPVPGF----------SDQLFHLGSLGVRED---LPGTGQAQVWM-KYEKSQF 187 Bdellovibrio...
jgi:Shew_0677   213 TYPDGTEVTLKRPLFAVENPFDAPGESLNSSnVTSELLQGDVLMGWRTGMPVFGLGLLEAIPEASILALVDENDADGDGI 292 Shewanella l...
Q12RB3          218 TYADGGQVSLKKPIFEVENPYDAPRETKQSSnVTSNLLQDDVLMGWRNGMPVFGLGLLEAIPEAAILALVDEQDSNKDGI 297 Shewanella d...
Q488R9          211 EYADGSSVELKKPIFSIEQPYDVSAENR----LDSAILQADVRYSPRNGMPVFGLGLLELISDADILANADENDSNSDGI 286 Colwellia ps...
WP_013377546    469 TFGDGTAYQLRRPNYTFTGPVPAN-------------------HSARIAPPLVGLGLLEALAESTLSSLADPDDTNRDGI 529 Stigmatella ...
OUHSC:BDW_01985 191 VYPDGEVVSLRKPLFKMTDAYDEVVLP-DGS-VQSRLYAKDVKISPRMSQPMFGLGLLEAIKESDILSLAS-RDLRHEGI 267 Bdellovibrio...
Q6MQA2          188 TYPDGDVVELRKPVFKVTGAYDEYFDSVSGE-MKSRLYEKDVRMGARIGTPMIGLGLLEAIKESDILALAQ-RDLSAEGV 265 Bdellovibrio...
jgi:Shew_0677   293 SGRANYVFDAVKAQRGESHPVSLGRFGWKANTPSVRVQSLGALRGDIGITNPLF--PEESIQGTSMHDSYltrtgfVDTG 370 Shewanella l...
Q12RB3          298 SGKANWVFDAIKANAGDPNPVSLGRFGWKANTPSVRVQSLGALRGDIGITNPLF--PEESIAGTSLHDSYltrtgfVDTG 375 Shewanella d...
Q488R9          287 SGRPNWVFDPIKAQSNDPVPVSLGRFGWKASTPSVRVQSLGALRGDMGVTNPLF--PDESIANTPLHESYltrtnfVDTG 364 Colwellia ps...
WP_013377546    530 SGRMQTVTDPQTGQQ------RLGRFGWKASKARLSHQIASALNTDMGVTTSIFrvPDCGAQQTC--------------- 588 Stigmatella ...
OUHSC:BDW_01985 268 AGKVNWVFDIEKFLSGNIYPVSMGRFGLKNNTPTVLHQSLGALRGDIGVTNYAF--PEESIFGTPLYENY------VQSS 339 Bdellovibrio...
Q6MQA2          266 SGKANWVFDIEKSMAGDPYPVSLGRFGLKNNTPSVLHQSLGALRGDIGVTNYAF--PDESIAGTPLYEAY-------RSG 336 Bdellovibrio...
jgi:Shew_0677   371 SGVDGEPEASAEFSDDVVFYAETLAVPARRQVDDVKVREGARLFEQVNCSGCHQPKFVTkss-geiGGLPMIEALKGQTI 449 Shewanella l...
Q12RB3          376 VDVDGAPEASAKFSDDVVFYAETLAVPARRNVSNSEVREGAKLFTELNCSACHTPSFVTkts-gdiGGQPMIAALKGQTI 454 Shewanella d...
Q488R9          365 VDEQGNTEASQEFSDEVVFYAETLAVPARRNIENESVIAGAQLFDQVNCTGCHQPDFTTakgellvGGLPAPDGLKGQKI 444 Colwellia ps...
WP_013377546    589 --PGASTELSDADLDKMVRYLAVLGVPARRNLGDAQARQGESLFGSAGCARCHTATLTT-------SPYHPLAELRGQTI 659 Stigmatella ...
OUHSC:BDW_01985 340 AHRADGLETTNEISDALVFYSQTLAVPSRRNIEDPEVIRGGRIFNQVGCASCHHPRYVT--------GSHPIQAFSQQTI 411 Bdellovibrio...
Q6MQA2          337 REPHAGVEATDQVANDIVFYSQTLAVPARRGATEAEVIRGAGIFHQVSCTTCHQPSFTT--------GDHPIKAFANQKI 408 Bdellovibrio...
jgi:Shew_0677   450 YPFSDMLLHDMGEGLSDARPDFLASGSEWRTRPLWGIGLTQTVNPQAGFLHDGRAASVEEAILWHGGEAQASTDKFMALT 529 Shewanella l...
Q12RB3          455 YPFSDMLLHDMGDGLSDGRPDFLANGNEWRTRPLWGIGLTQTVNPQAGFLHDGRAATLEEAILWHGGEALASQQAFMGLD 534 Shewanella d...
Q488R9          445 YPFTDMLLHDLGEGLADNRRDFTATGVEWKTRPLWGIGLTKTVNPAAGFLHDGRAATVEEAILWHGGEAQQSKADFMAMT 524 Colwellia ps...
WP_013377546    660 RPYTDLLLHDMGPGLADNLPEDGASGAEWRTPPLWGIGLTAATSGGEAYLHDGRARSLTEAILWHGGEAEASKEAFRTLS 739 Stigmatella ...
OUHSC:BDW_01985 412 YPFTDMLLHDMGEELADDRQDFDASGRDWKTRPLWGIGQTQTVNPRAGFLHDGRARTIEEAIVWHGGEGSHSRKRFSQLK 491 Bdellovibrio...
Q6MQA2          409 YPYTDLLLHDMGEGLADGRQDFDADGREWKTRPLWGMGHTQTINPRAGFLHDGRARTLEEAILWHGGEAEYSKNKFARLP 488 Bdellovibrio...
jgi:Shew_0677   530 QEERSQLLAFVMSL 543 Shewanella loihica PV-4
Q12RB3          535 KAKRSQLVAFLMSL 548 Shewanella denitrificans OS217
Q488R9          525 PADRQALLDFVMSL 538 Colwellia psychrerythraea 34H
WP_013377546    740 SANRAALLKFLQSL 753 Stigmatella aurantiaca
OUHSC:BDW_01985 492 KEERAALIRFVRSL 505 Bdellovibrio bacteriovorus W
Q6MQA2          489 KADRSALIQFIKSL 502 Bdellovibrio bacteriovorus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap