Conserved Protein Domain Family

pfam06530: Phage_antitermQ 
Phage antitermination protein Q
This family consists of several phage antitermination protein Q and related bacterial sequences. Antiterminator proteins control gene expression by recognising control signals near the promoter and preventing transcriptional termination which would otherwise occur at sites that may be a long way downstream.
PSSM-Id: 399498
Aligned: 33 rows
Threshold Bit Score: 134.269
Threshold Setting Gi: 499066601
Created: 11-May-2020
Updated: 7-Aug-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
WP_038241585             80 GYSKREIARDLRVSESLVRHKMQVAESFIAGCLEMLDIQLD 120 Xenorhabdus szentirmaii
WP_047780281             78 GLTFMKLAEKHHCSDGHIGKKLQNAEGCIEGMLMHLGVKLE 118 Pragia fontium
CCH:MU9_2675             78 GKTFIRLAKKYGCSDTHIGKKLQKAEGLVEGMLIMGDVKLE 118 Morganella morganii subsp. morganii KT
CAR42188                 76 GQTFIQLAQAHRCSDTYIGKKLKKAEGIVEGMLIMAELIFI 116 Proteus mirabilis HI4320
WP_045957936             78 GKTFMQLARDHHCSDTHIGKRLQKAEGVIEGMLMMLDVPLE 118 Xenorhabdus poinarii
utah:Sant_2913           78 GKTFMTLATEHHCSDTHIGKKLQNAEGVVDGFLMAMEIKLD 118 Sodalis praecaptivus
EHD21298                 78 GKTFMQLASKLHCSDTHVGKRLQKAEGTIDGMLMALDISLE 118 Brenneria sp. EniD312
Q47274                   78 GMTFMSLAGKHCCSDGYIGKRLQKAEGIIEGMLMALDIRLE 118 Escherichia coli K-12
KKF37051                 80 GHTTRHIAENMSLDRNAVRKSLVASEEFLEGCLVAMGVRLD 120 Erwinia tracheiphila
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap