Conserved Protein Domain Family
Phage_P2_GpE

?
pfam06528: Phage_P2_GpE 
Phage P2 GpE
This family consists of several phage and bacterial proteins which are closely related to the GpE tail protein from Phage P2.
Statistics
?
PSSM-Id: 399497
View PSSM: pfam06528
Aligned: 16 rows
Threshold Bit Score: 52.3367
Threshold Setting Gi: 219996108
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015698216     1 MADIAVIFHWRPAEMDAMTVEELLLWRDQAAARSGGD 37  Enterobacterales
ACR27327         1 MADIATVFHWAPRDMEGFSLSELMDWRERARIRSGTE 37  Burkholderia glumae BGR1
Q1QXS7           1 MADLAGVFHWTPNDCADFSLRELMEWRERARKRSGAD 37  Chromohalobacter salexigens DSM 3043
jgi:Daci_2623    1 MADLAMVFHWRPADMEDMSLAELGQWHERARERYESQ 37  Delftia acidovorans SPH-1
ACL32526        11 LADLVWWFGLNLNDLDRMKITEVNDWLKQANRQKKAG 47  Glaesserella parasuis SH0165
Q7NAC2           1 MADIATVFHWSPAVTDEMSLPELLDWRHRAILRSGAE 37  Photorhabdus laumondii subsp. laumondii
ADD78566         1 MADIASVFHWPPSEMYPMSLEELLDWRHRVMIRSGVT 37  Pantoea ananatis LMG 20103
IEC:ABF-0020302  1 MADIAVVFHWPPSALFPMSLAELINWRAKALQRSGQD 37  Dickeya dadantii 3937
wugsc:KPN_04861  7 MADIAVIFHWPPSELYPMSLTELTTWREKALQRSGNT 43  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
jgi:Tgr7_1627    1 MADVAFVFHWSPDWLMGRAASEILEWRDKALARWNHA 37  Thioalkalivibrio sulfidiphilus HL-EbGr7
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap