Conserved Protein Domain Family
NOA36

?
pfam06524: NOA36 
NOA36 protein
This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.
Statistics
?
PSSM-Id: 368953
View PSSM: pfam06524
Aligned: 8 rows
Threshold Bit Score: 439.27
Threshold Setting Gi: 122067021
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EEB12642       1 MPKKKTGQRKKAEKQKIRQKEIRSKKENLDLVKFPCNSVMECDKCERKQKNRAFCYFCQSLQRLPTCAQCGKVKCMLKTG 80  human body louse
EFN60936       1 MPKKKTGQRKKAEKQKLRQKEIRAAKEQVDLAKFPCNSVMECDKCNKKQKSRAFCYFCQSIQRLPMCAHCGKIKCMLKTG 80  Florida carpent...
Q9VAU9         1 MPKKKTGQRKKAEKQKLRLKEIRSR--EVPLADLPCNAPMECDKCEKKQKSRAFCYFCQSIQRLPICAQCGKIKCMLKTG 78  fruit fly
Q16GS0         1 MPKKKTGQRKKAEKQKLRQKEIRNR--ESQLPEQPCNLPMDCEKCGRKQKSRAFCYFCQSVQRLPICAHCGKQKCMLKTG 78  yellow fever mo...
XP_002416637   1 MPKKKTGQRKKAEKQKLRQKAIRDSAGRVNLGEHPCNAVMECDKCARKQKNRAFCYFCSALQRLPVCAKCGKMKCMMKSG 80  black-legged tick
XP_005797645   1 MPKKKTGARKKAENRKEREKQIRANREHVEVAKHPCNVNMECDKCQRKQKNRAFCYFCNSVQKLPVCAQCGKTKCM-KAS 79  southern platyfish
XP_006008994   1 MPKKKTGARKKAENRKEREKLMRAARGNIDLAKHPCNASMECDKCQRRQKNRAFCYFCSSVQKLPICAHCGKTKCMMKSS 80  coelacanth
ERE80276       1 MPKKKTGARKKAENRREREKQLRASRSTVDLAKHPCNASMECDKCQRRQKNRAFCYFCNSVQKLPICAQCGKTKCMMKSS 80  Chinese hamster
EEB12642      81 DCVVRHAGVFTTGLGMVGAICDFCESWVCHGRRCLTVHACSCPLQDAICVECERGVWDHGGRIFKCSFCASFLCEDDQFE 160 human body louse
EFN60936      81 DCVVRHPGIFTTGLGMVATICDYCEAWVCHGRRCLTSHACICPLTDAICQECERGVWDHGGRIFKCSFCDCFLCEDDQFE 160 Florida carpent...
Q9VAU9        79 DCVVKHPGVYTTGLGMVGAICDFCEAWVCHGRKCLQNHACTCPLQNATCLECERGVWEHGGRIFKCSFCNGFLCEDDQFE 158 fruit fly
Q16GS0        79 DCVVKHPGVYTTGLQMVGAICDHCEAWICHGRKCLQSHACICPLMDAVCIECERGVWDHGGRMYKCCFCDNFLCEDDQFE 158 yellow fever mo...
XP_002416637  81 DCVVKHPGQFTTGLSMVGAICDYCEAWVCHGRQCLTSHACTCPLQDATCIECERYVWEHGGRIFKCSFCNNFLCEDDQFE 160 black-legged tick
XP_005797645  80 DCVIKHPGIHSTGMAMVGAVCDFCEAWVCHGRKCLSTHACSCPLADADCIECERGVWDHGGRIFRCSFCRNFLCEDDQFE 159 southern platyfish
XP_006008994  81 DCVIKHSGVYSTGLAMVGAICDFCEAWVCHGKKCLSTHACSCPLADAECIECERTVWEHGGRIFSCSFCNNFLCEDDQFE 160 coelacanth
ERE80276      81 DCVIKHAGVYSTGLAMVGAICDFCEAWVCHGRKCLSTHACACPLTDAECVECERGVWDHGGRIFSCSFCHNFLCEDDQFE 160 Chinese hamster
EEB12642     161 HQASCQVLESENYKCQSCNKLGQYSCLKCKICFCEDHIRRKGFKYEKNKPLPCPKCGFETAQTKDLSVSTRTHKFGRQKQ 240 human body louse
EFN60936     161 HQASCQVLEAENFKCQSCNRLGQYSCLRCKTCYCEDHVRRKGFKYEKNKAIPCPKCSYETSQTKDLSMSTRSHKFGRQNQ 240 Florida carpent...
Q9VAU9       159 HQASCQVLESENYKCQSCNKLGQYSCLRCKTCYCEDHVRRKGFKYDKNKPIPCPKCNYDTSVTKDLSMSTRSHKFGRQQQ 238 fruit fly
Q16GS0       159 HQASCQVLESESYKCQSCNRLGQYSCLRCKTCYCEDHIRRKGFKYDKNKPIPCPKCNYDTNQTKDLSMSVRSHKYGRKRQ 238 yellow fever mo...
XP_002416637 161 HQASCQILEAETLKCMSCNRLGHHSCLRCKTCYCDDHVKRKGFKYERNQPVPCPKCGFETQQTKDLSMSTRHHSYGRQAM 240 black-legged tick
XP_005797645 160 HQASCQILQAETFKCVSCNRLGQHSCLRCKACYCDDHAKSKVFKQEKGKAPPCPKCGHETQETKDLSMSTRTLKFGRQA- 238 southern platyfish
XP_006008994 161 HQASCQVLEAETFKCVSCNRLGQHSCLRCKACFCDDHTRSKVFKQEKGKAPPCPKCGHETQETKDLSMSTRSVKFGRQS- 239 coelacanth
ERE80276     161 HQASCQVLEAETFKCVSCNRLGQHSCLRCKACFCDEHTRSKVFKQEKGKQPPCPKCGHETQETKDLSMSTRSLKFGRQT- 239 Chinese hamster
EEB12642     241 A-YSDDDDgdDPDYDFNN-----SSnyylnygvndndvTDSDNDNSGDEDDDDDDD---EEDEDDDDDDEEEDDDDDD-- 309 human body louse
EFN60936     241 GgPSESDD--ENEYDYGNqdscfASt-----------yTNNDEDNENDDDDDDDDD---DYDDDEDDDDEDGDNDEEL-- 302 Florida carpent...
Q9VAU9       239 GgNSDDEE------GYGGyygagGSgyyggaasggysyGGDDDEDESDGDYDDESD---EDDDDDEEEDETTESEPEK-- 307 fruit fly
Q16GS0       239 DdNDDDDDdyCYDAEYTAyr------------------aaADRYNETDSDDDDDYE---EGSDSDEEDDSESEEEEDE-- 295 yellow fever mo...
XP_002416637 241 SsGRDDDEddGYDYGGAGyygsgGGg--------------------GDLDDEDEDD---DEDDDDDDDDEDEESDEDE-- 295 black-legged tick
XP_005797645 239 --GGDDDDdyEGASGYDAywknlAA-------------GGSRQDDYGDDDDDDDEE---EEDDGYEEDDEEEEDEGEE-- 298 southern platyfish
XP_006008994 240 --GIEDAD---GASGYDAywknlAS----------------RGDDTGAQDEEDDYDfgeDEEEEEEEDDDDDEEEEEE-- 296 coelacanth
ERE80276     240 --GGEEGD---GASGYDAywknlSS---------------DKYADTGYHDDEEEDE---AEDEEEEEDGKDSDAESSDlf 296 Chinese hamster
EEB12642     310 ACDN 313 human body louse
EFN60936     303 SSTD 306 Florida carpenter ant
Q9VAU9       308 ETDK 311 fruit fly
Q16GS0       296 EKED 299 yellow fever mosquito
XP_002416637 296 SSDE 299 black-legged tick
XP_005797645 299 EDET 302 southern platyfish
XP_006008994 297 GEEA 300 coelacanth
ERE80276     297 TSLN 300 Chinese hamster
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap