2XRH


Conserved Protein Domain Family
DUF1104

?
pfam06518: DUF1104 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1104)
This family consists of several hypothetical proteins of unknown function which appear to be found largely in Helicobacter pylori.
Statistics
?
PSSM-Id: 399491
View PSSM: pfam06518
Aligned: 12 rows
Threshold Bit Score: 79.7359
Threshold Setting Gi: 315131763
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2XRH_A             10 DFSKTSDEDLAKMAGVV-APQDIVDYTKELKKRMEKMPE-DKRKAFHKQLHEYATKNTDKMTVADFEARQKAVKEALKKg 87  Helicobact...
O24943             23 DFKSMDDKQLLEQAGKV-APSEVPEFRAEVNKRLAVMKE-EDRKNYKADFKKAMDKNLASLSQEDRNKRKKEILEAIAN- 99  Helicobact...
CBY83374           20 DFAKLSDEELLKIAGTL-PASQALNYRMEVVKRLRSLDE-EHQKEFKKAFGQSARANLSKMSWKEFSHMREQVRKHLAK- 96  Helicobact...
CBY82391           22 DYSSLKTGEFLKLAGTLhNAEDVLDYQMEVAKRLKALKG-KARTNFKIKLDRTYKANLARMSAKDFMALRKEVASALEE- 99  Helicobact...
CCB80208           22 DYSSLSGPELIKLAGKV-PAEDALELRAAVHKHVESLKTaKAKNSFKWKFKQAAEAHFKKMKKKDFVAMREEVRKEFEE- 99  Helicobact...
CBG39415           18 DFSKMSNDDLAKMAGTV-DAKDFADYHMELHKRMHGMSK-DQMKDFAKEIREYREKNTDNMTLKEYREQREKIKEALEQ- 94  Helicobact...
CCB80209           26 SFKDKSNQELIEMAGKV-VPNEVPDYQMELFKRMKGMSA-EQKKKFHEQLKEAADKNTENMTMEEFEKRREAIRAAIKA- 102 Helicobact...
tigr:CHAB381_0527  20 DFSGKSSDELIKSLNTK-DPVVFADAMFELRKRV------GEQNKIIFKMRSAMCEQMSSKTPEERFKFKGEVHKAMSD- 91  Campylobac...
WP_006655071       24 DFSKKSNDELINLSGKV-TPKDYPDYKMEIHKRTQGMTL-QEARNFREQLRDKRQSVYDQMTLKEYREYRDAIAKETAK- 100 Helicobact...
Q7MSV3             22 DFSKKSNAELQSMAGSV-APKEVLDFKSEIHKRTQKMTV-AEARTFHQGMQKAMQEKMSKMTMEEAQKYHNEVRLEVQK- 98  Wolinella ...
EFR46909           26 DFSKKSDKELISLSGVV-KVEEFADYELEIAKRMKAKSE-KEAKDFREKLKAQYEKATENMSVKEYREYKKATHEAMKK- 102 Helicobact...
Q7VFM1             25 DFSSRSDAELVKLSGIV-KVEEFVDYELEVAKRLKSKTE-KEAKEFKSKLKEQYEKATEKLSVKQYREYKKATREAMKK- 101 Helicobact...
2XRH_A             88 NMEDMD 93  Helicobacter pylori 26695
O24943            100 KKKTMT 105 Helicobacter pylori
CBY83374           97 AKKKYS 102 Helicobacter felis ATCC 49179
CBY82391          100 KKKDHS 105 Helicobacter felis ATCC 49179
CCB80208          100 ATKEHS 105 Helicobacter bizzozeronii CIII-1
CBG39415           95 KVKGMS 100 Helicobacter mustelae 12198
CCB80209          103 RIAKMT 108 Helicobacter bizzozeronii CIII-1
tigr:CHAB381_0527  92 KIEKLS 97  Campylobacter hominis ATCC BAA-381
WP_006655071      101 RIDSMS 106 Helicobacter canadensis
Q7MSV3             99 QLDSMT 104 Wolinella succinogenes
EFR46909          103 RVENMS 108 Helicobacter cinaedi CCUG 18818 = ATCC BAA-847
Q7VFM1            102 HLEKMS 107 Helicobacter hepaticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap