Conserved Protein Domain Family
BDV_P10

?
pfam06515: BDV_P10 
Borna disease virus P10 protein
This family consists of several Borna disease virus P10 (or X) proteins. Borna disease virus (BDV) is unique among the non-segmented negative-strand RNA viruses of animals and man because it transcribes and replicates its genome in the nucleus of the infected cell. It has been suggested that the p10 protein plays a role in viral RNA synthesis or ribonucleoprotein transport.
Statistics
?
PSSM-Id: 115187
View PSSM: pfam06515
Aligned: 3 rows
Threshold Bit Score: 144.127
Threshold Setting Gi: 81929655
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5GLA6  1 MSSDLRLTLLELVRRLNGSATIESGRLPGGRRRSPDTTTGTIGVTKTTEDPKECTDPTSRPAPEGPQEEPLHDLRPRPAN 80  Borna disease virus
Q9Q9V0  1 MSSDLRLTLLELVRRLNGNTTVESGRLSGGRRRSPDTTTGAVGITKTKEDSKECTDPASGPAPEGSPEEPLHDLRSRSAN 80  Borna disease virus
Q86622  1 MSSDLRLTLLELVRRLNGNATIESGRLPGGRRRSPDTTTGTVGVTKTTEDPKECIDPTGRPAPEGPQEEPLHDLRPRPAN 80  Borna disease virus
Q5GLA6 81 RKGAAVE 87  Borna disease virus
Q9Q9V0 81 RKGAAIE 87  Borna disease virus
Q86622 81 RKGAAIE 87  Borna disease virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap