2P7N,2YM9


Conserved Protein Domain Family
IpaD

?
pfam06511: IpaD 
Click on image for an interactive view with Cn3D
Invasion plasmid antigen IpaD
This family consists of several invasion plasmid antigen IpaD proteins. Entry of Shigella flexneri into epithelial cells and lysis of the phagosome involve the IpaB, IpaC, and IpaD proteins, which are secreted by type III secretion machinery.
Statistics
?
PSSM-Id: 399488
View PSSM: pfam06511
Aligned: 3 rows
Threshold Bit Score: 474.203
Threshold Setting Gi: 123560687
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2P7N_A  40 APQGSAA-PALAAARAKADelgQAAREVRASVE--------------RQTAYETRLAAQRSAAafsggep-----pqarr 99  Chromobacterium viola...
2YM9_A   8 QNYSASPhPGIVAERPQTP---SASEHVETAVVpsttehrgtdiislSQAATKIHQAQQTLQS----------------- 67  Salmonella enterica s...
Q326T1   1 MNITTLTnSISTSSFSPNNtngSSTETVNSDIKtttsshpvssltmlNDTLHNIRTTNQALKKdlsqktltktsleeial 80  Shigella dysenteriae ...
2P7N_A 100 eAPGAElDEARNAQTVSARLFEGNLKGVAQSGHAXSAEQKQALQSGLddvfaDAPPQARSAGAPXlysanAAAGQGXADS 179 Chromobacterium viola...
2YM9_A  68 -TPPIS-EENNDERTLARQQLTSSLNALAKSGVSLSAEQNENLRSAF-----SAPTSALFSASPM-----AQPRTTISDA 135 Salmonella enterica s...
Q326T1  81 hSSQISmDVNKSAQL---------LDILSKKEYPINKDARELLH--------SAPEEAELDGYQM-----------ISHR 132 Shigella dysenteriae ...
2P7N_A 180 DLWDXISDQIGKIKDNYLGVYENVVGQYTDFYKAFSDILSQXANWIKPGG-DGNKVKLNVDALKAALEKLKKDFslgdNL 258 Chromobacterium viola...
2YM9_A 136 EIWDMVSQNISAIGDSYLGVYENVVAVYTDFYQAFSDILSKMGGWLLPGK-DGNTVKLDVTSLKNDLNSLVNKY----NQ 210 Salmonella enterica s...
Q326T1 133 ELWDKIAKSINNINEQYLKVYEHAVSSYTQMYQDFSAVLSSLAGWISPGGnDGNSVKLQVNSLKAELTKLKEKY------ 206 Shigella dysenteriae ...
2P7N_A 259 DNKKAVLFPAQSkDGGIQGGSESDARKWAKEXGLPDApppgfscVQKAADGNWVVVVDXTPIDTXIRDVGALGS---GTE 335 Chromobacterium viola...
2YM9_A 211 INSNTVLFPAQS-GSGVKVATEAEARQWLSELNLPNS-------CLKSYGSGYVVTVDLTPLQKMVQDIDGLGApgkDSK 282 Salmonella enterica s...
Q326T1 207 --EDKPLYPANN------TVSKEQADKWLTELGgt-------igTVSRKNGGYVVNINMSPIDNMLKSLNNLGG---NGE 268 Shigella dysenteriae ...
2P7N_A 336 LELDNAKFQAWQSGFKAQEENLKNTLQTLTQKYSNANSLFDNLVKVLSSTISSCLETAKSFL 397 Chromobacterium violaceum
2YM9_A 283 LEMDNAKYQAWQSGFKAQEENMKTTLQTLTQKYSNANSLYDNLVKVLSSTISSSLETAKSFL 344 Salmonella enterica subsp. enterica ser...
Q326T1 269 VVLDNAKYQAWNAGFSAEDETMKNNLQTLVQKYSNANSIFDNLVKVLSSTISSCTDTDKLFL 330 Shigella dysenteriae Sd197
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap