Conserved Protein Domain Family
Ten_N

?
pfam06484: Ten_N 
Teneurin Intracellular Region
This family is found in the intracellular N-terminal region of the Teneurin family of proteins. These proteins are 'pair-rule' genes and are involved in tissue patterning, specifically probably neural patterning. The intracellular domain is cleaved in response to homophilic interaction of the extracellular domain, and translocates to the nucleus. Here it probably carries out to some transcriptional regulatory activity. The length of this region and the conservation suggests that there may be two structural domains here (personal obs:C Yeats).
Statistics
?
PSSM-Id: 399476
View PSSM: pfam06484
Aligned: 8 rows
Threshold Bit Score: 486.759
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015197076   11 SLT-ARRDAERRYTSSSADSEE--SKLH-PKSYSSSETLKAFDQD-SRLVYGNRVKDMVHQEADEFGRQGTDFSLRELGF 85   spotted gar
Q9WTS5         10 SLTrGRCGKECRYTSSSLDSED--CRVPtQKSYSSSETLKAYDHD-SRMHYGNRVTDLVHRESDEFSRQGTNFTLAELGI 86   house mouse
XP_016153468   11 SLTkSRRDKERRYTNSSAENEE--CRVPtQKSYSSSETLKAFDHDsSRLLYGNRVKDLVHREADEYTRQGQNFTLRQLGV 88   Collared flyc...
5_pfamImport    1 ----RDKDRERRYTASSSDRDEgaCRVPtQKSYSSSETLQAFDHDpSRMLFGGRVKEMVHKETAEYTRPGQTFSLRQLGI 76  
4_pfamImport    1 -----DVDQEPRYTASTADREEgtCRVPtQKSYSSSETLQAFDHDpSRMLFGGRVKEMVHKESAEYSRPGQTFSLRQFGI 75  
XP_029699366   11 SLT-ARQDTERRYTSSSADSED--GKPN-PKSYSSSETLKAFDHD-SRMAYGSRVKEMVHHEVDEFSRQGVDFSLRNLGF 85   torafugu
NP_001096158   11 SLT-RRRDTERRYTSSSADSDD--SKVP-QKSYSSSETLKAYDQD-SRLTYSNRVKDMVHQEIDEFCRSGGSFTLHELGL 85   tropical claw...
XP_013042782   11 SLT-RRRDTERRYTSSSAESED--SKVP-QKSYSSSETLKAYDQD-SRLTYSNRVKDMVHQEADEFCRAGANFSLRELGL 85   Anser cygnoid...
XP_015197076   86 GEGMPlHGTSYRTEIGLPHRGFSISAGSDADTETDGIMSPEHAVRLWGRn-TKSGRSSCLSSRANSNLTLTDTEHENTEN 164  spotted gar
Q9WTS5         87 CEPSP-HRSGYCSDMGILHQGYSLSTGSDADSDTEGGMSPEHAIRLWGRg-IKSRRSSGLSSRENSALTLTDSDNENKSD 164  house mouse
XP_016153468   89 CEPAArRGLAFCAEMGLPHRGYSISAGSDADTENEGVMSPEHAMRLWGRg-VKSGRSSCLSSRSNSALTLTDTEHENKSD 167  Collared flyc...
5_pfamImport   77 CEPPArRGLALCPETGLSHPLSSYSRGPVA-TENHEPVSPERTITLWGTg-AKSGQNSCLSSRSNSALTLTDTEMDNKSD 154 
4_pfamImport   76 CEPSArRGLAPCPETGPSHPLSSYCRGPAA-AENHEPASPERTMTLWG---AKSGQNSCLSSRSNSALTLTDTEMDNKSD 151 
XP_029699366   86 GEALPsHVATYRTEMGLPHRDYSVSVGSDPDTETDGIMSPEHAVRLWGRsnTKSGRSSCLSSRANSNLTLTDTEHENTEN 165  torafugu
NP_001096158   86 GEVSPpHGTLYRTDLGLPHCGYSMTSDNDADTEPDAVLSPEHPVRLWARs-TKSGRSSCLSSRANSNLTLTDTEHENTEN 164  tropical claw...
XP_013042782   86 EDVTPtHGTLYRTDIGLPHCGYSISTGSDADTEADVVMSPEHPVRLWGRn-TKSGRSSCLSSRANSNLTLTDTEHENTET 164  Anser cygnoid...
XP_015197076  165 ---GPPLHCSSAS---------STpveqSPSP-----PpsleaNESQRRLLGNS-----VVQPTPDSDSEEEFAPNSFL- 221  spotted gar
Q9WTS5        165 ddnGRPIPPTSSSsllpsaqlpSS----HNPP-----P-----VSCQMPLLDSN-----TSHQIMDTNPDEEFSPNSYL- 224  house mouse
XP_016153468  168 senGPPMPSSSSSp--------SVtehlHSPP-----Psp-nlHDNQRWLLSNN-----ASQPVQDSDTDEDYTAGSYL- 227  Collared flyc...
5_pfamImport  155 nemGEYFPPTSSIrrqktahfiSShn---lNPvyknmPmkn----------------psTARRDEDRIPATESSPFKFAs 215 
4_pfamImport  152 netGRKIKPSTCQql------iTAesapVSQPp---------pTKNQEPDMARN-----SWHKELNVNPSDFFSPQAKL- 210 
XP_029699366  166 g---PPLHCSSAS---------SSpveqLPYP-----PpsiaaNESQRGLLGNS-----AAQPAQDSDSEDEFGPNSFL- 222  torafugu
NP_001096158  165 ---GPPLHCSSAS---------SSpieqTPSP-----PpspaaNECQRRLLGSSvapaaAAAAAQDSDSEGDFVPNSFL- 226  tropical claw...
XP_013042782  165 -----------------------------DHP-----P------------------------------------------ 168  Anser cygnoid...
XP_015197076  222 --VKTGSGNLCAPttaaEDQSSSFQNHSRLRTpp---lPVSHSHTP-NQHHAASANSLNRGNYTPRSNPSPAPtdHSLPP 295  spotted gar
Q9WTS5        225 --LRACSGPQQAS----SSGPPNHHSQSTLRP------PLPPPHNHtLSHHHSSANSLNRNSLTNRRSQIHAP--APAPN 290  house mouse
XP_016153468  228 --VQTGDNPVSVPg---HEQPPNNQGQSTLQ-------PLPPSHKQhSAQHHPSITSLNRNSLTNRRNQSPAPp-AALPA 294  Collared flyc...
5_pfamImport  216 yfLFIFSAEVKES-------TSSPGDHLSSQQappplpPAPPPHKQ-----HPSITSLSRSSLANQRSPSPPPt-AGLAA 282 
4_pfamImport  211 --LRIFQSSASIC-----------------KPgppplpPAPPPHRQ-----HPSITSLSRSSLANQRSPSPPPt-AGLAA 265 
XP_029699366  223 --VKTGSGNLYTPataaAEEGA-FQNHSRLRTpp---lPLSHSHSPsHQHHAASINSLNRSNYTQRSNPSPAPtdSSVPP 296  torafugu
NP_001096158  227 --VKSDSANLAVPa---NDQPLVLQNH--LRLrtp-ppPLSHPQIP---HHAASINSLNRGNYTPRSNPSPAPtdHSLSG 295  tropical claw...
XP_013042782  169 ----------------------NLQNHSRLRTpp---pPISHAHTP-NQHHAASINSLNRGNFTPRSNPSPAPtdHSLSG 222  Anser cygnoid...
XP_015197076  296 EGP--TQDSGSAQDNWLLNSNIPLETRniakqtfletlqdnliemdilasahrdgaysegHFLFKPG-GTSPLFCTTSPG 372  spotted gar
Q9WTS5        291 DLAt-TPESVQLQDSWVLNSNVPLETR---------------------------------HFLFKTSsGSTPLFSSSSPG 336  house mouse
XP_016153468  295 ELQt-TPESVQLQDSWVLGSNAPLESRelesqavlanghdnli--emdvfsptyhdssygHFLFKTGtGTTPLFSTATPG 371  Collared flyc...
5_pfamImport  283 DLQs-TAECVQLQDSWVLGSNVALESR---------------------------------HFLFKTGtGTTPFFGAAAPG 328 
4_pfamImport  266 DLQs-TAECVQLQDSWVLGSNVALESR---------------------------------HFLFKTGtGSTPFFGAAAPG 311 
XP_029699366  297 EGPa-NQDSVSVQDNWLLNSNIPLETR---------------------------------QFLFKPG-GTSPMYCTTSPG 341  torafugu
NP_001096158  296 EPPggGQEAIHAQDNWLLNSNIPLETR---------------------------------HFLFKPG-GTSPLFCTTSPG 341  tropical claw...
XP_013042782  223 EQPasTQEPAHAQDNWLLNSNIPLETR---------------------------------HFLFKPG-GTSPLFCTTSPG 268  Anser cygnoid...
XP_015197076  373 YPLTSSTVYSPPPRPLPRSTFSRPAFNLKKPYKYCNWK 410  spotted gar
Q9WTS5        337 YPLTSGTVYTPPPRLLPRNTFSRKAFKLKKPSKYCSWK 374  house mouse
XP_016153468  372 YTMASGSVYSPPTRPLPRNTLSRSAFKFKKSSKYCSWK 409  Collared flycatcher
5_pfamImport  329 YTMATGTVYSTPARPLPRNSLSRGAFKFKKSPKHCSWK 366 
4_pfamImport  312 YTMATGTVYSTPARPLPRNTLSRGAFKFKKSPKYCSWK 349 
XP_029699366  342 YPLTSSTVYSPPPRPLPRNTFSRPAFSLKKPYKHCNWK 379  torafugu
NP_001096158  342 YPLTSSTVYSPPPRPLPRSTFSRPAFNLKKPYKYCNWK 379  tropical clawed frog
XP_013042782  269 YPLTSSTVYSPPPRPLPRSTFSRPAFNLKKPYKYCNWK 306  Anser cygnoides domesticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap