Conserved Protein Domain Family
ChiC

?
pfam06483: ChiC 
Chitinase C
This ~170 aa region is found at the C-terminus of pfam00704.
Statistics
?
PSSM-Id: 368936
View PSSM: pfam06483
Aligned: 21 rows
Threshold Bit Score: 241.448
Threshold Setting Gi: 407884604
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_003963492   1048 QYVMGYDTTTRIADGLRGAGAYRGERAGAtPLPGQVLDVSAEFTGYPTAEADlWPQQPKLRITNNSTRPLPSGTELSFDI 1127 Streptomyce...
WP_016333057    540 QYFMGDTLITKINDGLRGAAPYGNVKSPR-PAPSSVLNAHVNLTGFALGDAN-YPITPRMRITNNSTTTIPGGTKIEFDY 617  Amycolatops...
jgi:Micau_5783  547 QYGMGDTLTTLLYDRLKAAPAYGARKAGI-TMPTRTLDVAVGMGGFALGDNN-YPINPELRLTNNTGAPIPAGAHLEFDY 624  Micromonosp...
WP_015045948    902 QYEMGHTLTKAIAQKFAAATPYGNQRAEI-AMPGEAIDIGVKLTNYALGDSN-YPITPDLIITNNSGVDLPGGTEFTFDF 979  Simiduia ag...
Q84AP8          900 QYEMGHTLTTAIADKFANAPAYGNQRAEI-DMPQQTLDIGIKLTNFALGDNN-FPITPDLIITNNTGQNLPGGTEFYFDI 977  Saccharopha...
Q9KLP3          804 EYHMGNTMTKAIYDKFKVATPYGNKVATG-AIPAEAVNIAVKVGGFKVGDQN-YPINPKITFTNNTGIDIPGGTEFQFDI 881  Vibrio chol...
Q6LQ31          219 EYHMGNTMTKAIYDKFKSATPYGNTVATG-PIPTEAVDITVSISGFKVGDKN-YPINPKLTFTNNTGSELPGGTEFQFDI 296  Photobacter...
Q2SMW0          789 EYFMGDTLTTQFYDAFKNAAPYGDQVGS--DVPATSLDIKYSISGFKLGDQN-YPINPKLKITNNSGQTIPGGTTFEFNV 865  Hahella che...
tigr:AHA_3440   756 EYGMGSTLTTLAYEKFAKAAKYNTQQNDL-AAPTAQLDIAVSLSGFKEGDSN-YPINPILKLTNNSTQTIPGGTRIEFLV 833  Aeromonas h...
Q9KT32          841 EYVIGSDMTSYAHEVFAAAKPMDIRHNDL-PQPDSVIDVTVSTTEWPEGDSN-YPINPKLVFTNHSNVAIPGGSTIEFLM 918  Vibrio chol...
WP_003963492   1128 PTSAPPLLKDDAWQDMKdAVQPGRSGP--NTGGLKADFHRVTIKLGHCESIAPGKSREIGVKYFLPLTG-PANFTLKTGG 1204 Streptomyce...
WP_016333057    618 GTSAPGSMSDQSGFGLT-VTSKGHSGP--NVGGMKGDFQHVAVTVPSWQNIAPGATVEIRLNYYMPIAS-PSNFTFTFGG 693  Amycolatops...
jgi:Micau_5783  625 PTTTPATLSQQSGWALT-TVTTGHTGS--NVGGLKGDHNRVRLTVPA--AIAPGSYAEVTLNYQLPISG-PANFTLAFGG 698  Micromonosp...
WP_015045948    980 ATSTPDNMADQSAAGLT-VITNGSNAAgnNVGGLENNFHRVKISTPSYLTLAQGEEWKVVLKYYLPVSM-PSNWVVKVGA 1057 Simiduia ag...
Q84AP8          978 ATSTPDNMGDQSAASLT-IVSNGSNAAgnNVGGLENNFHRVKISTPSYLTLADGEEWKVVLKYYLPVSM-PSNWVVNVAG 1055 Saccharopha...
Q9KLP3          882 PVSAPDNAKDQSGGGLK-VIASGHTRAn-NIGGLDGTMHRVAFSLPAWKSLPAGATYELDMVYYLPISG-PANYTVKINN 958  Vibrio chol...
Q6LQ31          297 PTSAPDNATDQSGGGLA-VIASGHVAAn-NIGGLQGEMHRVAFTLPSWKNLPNGGTYELDMVYYLPISG-PANYAVNING 373  Photobacter...
Q2SMW0          866 PTAIPDTISDQSGVGLK-VIASGANSSgnNIGGLENDHHTVAFTLKNYQALADGESMDITLNYHLPMAT-PSSWRVKIDG 943  Hahella che...
tigr:AHA_3440   834 PTSTSDTITDQSGMGLK-VVESGGNQNsdGIAG-EKDFHKAAFTLPTWKAWAPGSDVEVAMTYYLPAAGvPSGIRIISGT 911  Aeromonas h...
Q9KT32          919 PTSSGDIVKDWSGAGLK-VIESGHTGSnfSVNGEKKLFHKVAVTLRSTETIPAGGEYSVDMVYYTPVSGvANGVRFIVGN 997  Vibrio chol...
WP_003963492   1205 TTYGLTQDRRRGTTTvEP 1222 Streptomyces clavuligerus
WP_016333057    694 TTYAIASDNPRGGGT-PP 710  Amycolatopsis keratiniphila
jgi:Micau_5783  699 QTYALAGDWARGGEVvTP 716  Micromonospora aurantiaca ATCC 27029
WP_015045948   1058 QEFALLQEYPE-----LP 1070 Simiduia agarivorans
Q84AP8         1056 EEFALSSEYPN-----LP 1068 Saccharophagus degradans 2-40
Q9KLP3          959 VEYAFSFEQPD-----LP 971  Vibrio cholerae
Q6LQ31          374 KEYALKFEYPD-----LP 386  Photobacterium profundum
Q2SMW0          944 ATFALKQEHPE-----LP 956  Hahella chejuensis KCTC 2396
tigr:AHA_3440   912 QTAGLKAEFPT-----LP 924  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Q9KT32          998 ETVGLKKDFPT-----LP 1010 Vibrio cholerae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap