6JBJ


Conserved Protein Domain Family
ABC_membrane_2

?
pfam06472: ABC_membrane_2 
Click on image for an interactive view with Cn3D
ABC transporter transmembrane region 2
This domain covers the transmembrane of a small family of ABC transporters and shares sequence similarity with pfam00664. Mutations in this domain in ABCD3 are believed responsible for Zellweger Syndrome-2; mutations in ABCD1 are responsible for recessive X-linked adrenoleukodystrophy. A Saccharomyces cerevisiae homolog is involved in the import of long-chain fatty acids.
Statistics
?
PSSM-Id: 399466
View PSSM: pfam06472
Aligned: 25 rows
Threshold Bit Score: 266.398
Threshold Setting Gi: 465683
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6JBJ_A         69 ILKVLF-PSWSSQNALMFLTLLCLTLLEQFVIYQVGLIPSQYYGVLGN--------------KDLEGFKTLTFLAVMLIV 133  human
P16970         70 ILKIMV-PRTFCKETGYLILIAVMLVSRTYCDVWMIQNGTLIESGIIG--------------RSSKDFKRYLFNFIAAMP 134  Norway rat
Q89DA2         14 IAVPYFrSEDKWVGRGLLAAVIAMELALVAIDVLVNQWQNRFYSALQA--------------SDWDAFVTQIWIFVALAS 79   Bradyrhizobiu...
Q9CLX7         45 LAEDYFhPKHNLLPLFYFMIIVFFNLLSVRIDILVSNWYNALYKSLQD--------------MNETVFWQQMVVFAVIAS 110  Pasteurella m...
WP_010908710   53 ITRGYFiGPQSVGVWLMLAVLLFSVVISVRLNVLFSYQSKDLYNALQAafegagaqndlvkqSGMHGFWMSLGIFSILAV 132  Mycobacterium...
Q18843         17 LLKILFpCHRRSITAWLAGALLIATALDQVMTYLVGIQPSLFYVALGN--------------KDADTFKILCARGAAIIL 82   Caenorhabditi...
Q94FB9        747 MLNVLI-PTIFDKQGAQLLAVACLVVSRTLISDRIASLNGTTVKYVLE--------------QDKAAFVRLIGLSVLQSG 811  thale cress
Q94FB9         93 LTAILL-SQMGKMGARDLLALVATVVFRTALSNRLAKVQGFLFRAAFL--------------RRAPLFLRLISENIMLCF 157  thale cress
Q8T8P3        106 IIRIVI-PSLKSKEFLSLLYLTALLFARTMLSVSIAEIAGKNAQNLVA--------------RKWKEMRNGVLKFALVSI 170  Dictyostelium...
Q4DXX9         75 LLRVCF-PRIVSAESGLVLLLTSLLMLRTTLTLTFSQISASNTKALMQ--------------KNFRHFIFGLLDVAVYAI 139  Trypanosoma c...
6JBJ_A        134 LNSTLKSFDQFTCNLLYVSWRKDLTEHLHRLYFRGRAYYTLNVLRD---DIDNPDQRISQDVERFC-----------R-Q 198  human
P16970        135 LISLVNNFLKYGLNELKLCFRVRLTRYLYEEYLQAFTYYKMGNLDN---RIANPDQLLTQDVEKFC-----------N-S 199  Norway rat
Q89DA2         80 MFIALAVYKLYLNQWLQIRWRQWLTRHYLGEWLQGATHYRMQLKGD---AADNPDQRITEDVKNFV-----------E-Q 144  Bradyrhizobiu...
Q9CLX7        111 SSITNALLTYYLSKRFLIHWRMWLNNRMLNKWTENQAYYKTQYVEA---QLDNPDQRIQQDVSSFV-----------S-T 175  Pasteurella m...
WP_010908710  133 IFIARVMADIYLTQRFIIAWRMWLTNHLTTDWLDQRAYYREQFIDN---TIDNPDQRIQQDIDIFTagaggtpngpsNgT 209  Mycobacterium...
Q18843         83 GKAFTLAVFKYLTNMLAIKSRQVCNLTMHRLYFKRQAFFKLSSSGD---MLDNPDQRLTQDIEKAT-----------RiL 148  Caenorhabditi...
Q94FB9        812 ASSIIAPSLRHLTQRLALGWRIRLTQHLLRNYLRNNAFYKVFHMSG---NSIDADQRLTRDLEKLT-----------A-D 876  thale cress
Q94FB9        158 MLSTLHSTSKYITGALSLRFRKILTKIIHSHYFENMVYYKISHVDG---RITHPEQRIASDVPRFS-----------S-E 222  thale cress
Q8T8P3        171 PASFVNASLKYETDMLALRFRKRLSEYVHKEYLEGVNFYKASHLGGadrI-DNADQRVTSDIEQFC-----------N-S 237  Dictyostelium...
Q4DXX9        140 PATITGVGINYATATLEQCFRGNLQNALHQEYFEGCKMYD-LAIKG---LVDNPAHRVTHDVQRFC-----------S-E 203  Trypanosoma c...
6JBJ_A        199 LSSMASKLIISPFTLVYYTYQCFQSTGWLGP--------------VSIFGYFILGTVVNKTLMGPIVMKLVHQEKLEGDF 264  human
P16970        200 VVDLYSNLSKPFLDIVLYIFKLTSAIGAQGP--------------ASMMAYLLVSGLFLTRLRRPIGKMTIMEQKYEGEY 265  Norway rat
Q89DA2        145 TLTIGLGLLSSIVTLFSFVIILWGLSNAAPLhlfgtdlmipgylcWGALVYAIFGTALTHWIGAPLVNLNFEQQRYEADF 224  Bradyrhizobiu...
Q9CLX7        176 SLDFATGLISSIVSIIAFTIILWNLSGPMTIaniei----phamvFLVFIYVLFSSIVAFKIGRPLIQLNFANERLNANY 251  Pasteurella m...
WP_010908710  210 GSTLLFGAVESVISVISFTAILWNLSGRLAVfefei----pramfWIVIVYVLLATIITFWIGRPLIGLNFANEKLNAAF 285  Mycobacterium...
Q18843        149 SNDLLAPIATAPFIIGYYTWLTYESSGWIGP--------------AAIYTYFCIQTIINKMILSPIVQKVSEQEKMEGDF 214  Caenorhabditi...
Q94FB9        877 LSGLLTGMVKPSVDILWFTWRMKLLTGQRGV--------------AILYTYMLLGLGFLRRVAPDFGDLAGEEQQLEGKF 942  thale cress
Q94FB9        223 LSDLILDDLTAVTDGILYAWRLCSYASPKYI--------------FWILAYVLGAGTAIRNFSPSFGKLMSKEQQLEGEY 288  thale cress
Q8T8P3        238 MSSLYTTLFKPFLDLVLFTRKLVVVMGWGSP--------------LLMFSYFIVSGFLKKLIMPPFGRLTAKQSELEGNY 303  Dictyostelium...
Q4DXX9        204 LSGLFPAVIKPILDIAIFSSALAGFGGYGVP--------------LVMMLYYAFVALMFRMLLPNFAGWVARSREKEGNL 269  Trypanosoma c...
6JBJ_A        265 RFKHMQIRVNAEPAAFYRAGHVEHMRTDRRLQRLLQTQRELMSKELWLYIGINTF-DYLGSILSYVVIAIPIF 336  human
P16970        266 RFVNSRLITNSEEIAFYNGNKREKQTIHSVFRKLVEHLHNFIFFRFSMGFIDSIIaKYIATVVGYLVVSRPFL 338  Norway rat
Q89DA2        225 RFHLVRVRENSEQIALLKGEGAERGRLLGRFGLVIGNWYAIMSRTKRLTAFTASY-QQAAVIFPYVLVAPAFF 296  Bradyrhizobium japon...
Q9CLX7        252 RYSLIRLKEYAESIAFYRGEKMEKRLLTTQFNQVIDNVWQVIYRTLKLSGFNLII-TQISVVFPLVIQVTRYF 323  Pasteurella multocida
WP_010908710  286 RYALVRLRDAAEAVAFYRGEEAERKQLEQRFTPIIDNYRRYVSRTIRFLGWNASV-SQTIVPLPWILQAPRLF 357  Mycobacterium leprae
Q18843        215 RQRHMEVRSNVEAIAFYRAGVLENIMTNQKLKNLIETQKSLTEWRMVLNSITNVF-DYFGGILSYLIIGVPVF 286  Caenorhabditis elegans
Q94FB9        943 RFMHERLNTHAESIAFFGGGAREKAMVDKKFRALLDHSLMLLRKKWLYGILDDFVtKQLPNNVTWGLSLLYAL 1015 thale cress
Q94FB9        289 RQLHSRLRTHSESIAFYGGETREESHIQQKFKNLVSHMSHVLHDHWWFGMIQDFLlKYLGATVAVILIIEPFF 361  thale cress
Q8T8P3        304 RTVHQRLITNAEEIAFYDGSRKERQIINLSFGDIYNHTGYVSYLKCLVGIFDGFLvKYCASIVGYGCMVLPIY 376  Dictyostelium discoi...
Q4DXX9        270 RLLHTQLIQHAEEVAFYRGAEIEGENAERLLESFICVERRLKRAKWWSTFINGILvKYAATGVGYAVCAVVVa 342  Trypanosoma cruzi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap