5C8T


Conserved Protein Domain Family
NSP11

?
pfam06471: NSP11 
NSP11
This region of coronavirus polyproteins encodes the NSP11 protein.
Statistics
?
PSSM-Id: 399465
Aligned: 7 rows
Threshold Bit Score: 901.825
Threshold Setting Gi: 212681379
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5C8T_B          4 NVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEG---LCVDipgiPKDM-TYRRLISMMGFKMNYQVNGYPNMFITREE 79  
Q98VG9       5555 ETCGLFKDCSKSEQYIPPAYATTYMSLSDNFKTSDglaVNIG----TKDV-KYANVISYMGFRFEANIPGYHTLFCTRDF 5629 Feline infect...
P0C6X1       5595 SSCGLFKDCARNPIDLPPSHATTYLSLSDRFKTSGdlaVQIG----NNNVcTYEHVISYMGFRFDVSMPGSHSLFCTRDF 5670 Human coronav...
P0C6X9       5983 CTTNLFKDCSRSYVGYHPAHAPSFLAVDDKYKVGGdlaVCLNv--aDSAV-TYSRLISLMGFKLDLTLDGYCKLFITRDE 6059 Murine hepati...
P0C6Y1       5468 QGTGLFKICNKEFSGVHPAYAVTTKALAATYKVNDelaALVNve-aGSEI-TYKHLISLLGFKMSVNVEGCHNMFITRDE 5545 Avian infecti...
YP_002308496 5169 LLCPLFKRCSYEYSGLHPAHALTWHDCGAEYRCDEplaKLVGv--sDGTLvSYKTLVSALGFLPSLKIETYHNMFLTKEA 5246 Thrush corona...
P0C6X7       5905 NVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEG---LCVDipgiPKDM-TYRRLISMMGFKMNYQVNGYPNMFITREE 5980 Severe acute ...
5C8T_B         80 AIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAVPTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLP 159 
Q98VG9       5630 AMRNVRAWLGFDVEGAHVCGDNVGTNVPLQLGFSNGVDFVVQTEGCVVTEKGNSIEVVKARAPPGEQFAHLIPLMRKGQP 5709 Feline infect...
P0C6X1       5671 AMRHVRGWLGMDVEGAHVTGDNVGTNVPLQVGFSNGVDFVAQPEGCVLTNTGSVVKPVRARAPPGEQFTHIVPLLRKGQP 5750 Human coronav...
P0C6X9       6060 AIKRVRAWVGFDAEGAHAIRDSIGTNFPLQLGFSTGIDFVVEATGMFAERDGYVFKKAAARAPPGEQFKHLIPLMSRGQK 6139 Murine hepati...
P0C6Y1       5546 AIRNVRGWVGFDVEATHACGTNIGTNLPFQVGFSTGADFVVTPEGLVDTSIGNNFEPVNSKAPPGEQFNHLRVLFKSAKP 5625 Avian infecti...
YP_002308496 5247 CRTYVQSWIGIDVEAAHAVKPNVGTNLPLQIGFSTGKNFSVTPEGIWVNEFGSCTEPVPAKIPPGEQFRHLKRDMRQARP 5326 Thrush corona...
P0C6X7       5981 AIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAVPTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLP 6060 Severe acute ...
5C8T_B        160 WNVVRIKIVQMLSDTLKGLSDRVVFVLWAHGFELTSMKYFVKIGPERTCClCDKRATCFSTSSDTYACWNHSV----GFD 235 
Q98VG9       5710 WHIVRRRIVQMVCDYFDGLSDILIFVLWAGGLELTTMRYFVKIGRPQKCE-CGKSATCYSSSQCVYACFKHAL----GCD 5784 Feline infect...
P0C6X1       5751 WSVLRKRIVQMIADFLAGSSDVLVFVLWAGGLELTTMRYFVKIGAVKHCQ-CGTVATCYNSVSNDYCCFKHAL----GCD 5825 Human coronav...
P0C6X9       6140 WDVVRIRIVQMLSDHLVDLADSVVLVTWAASFELTCLRYFAKVGREVVCSvCTKRATCFNSRTGYYGCWRHSY----SCD 6215 Murine hepati...
P0C6Y1       5626 WHVIRPRIVQMLADNLCNVSDCVVFVTWCHGLELTTLRYFVKIGKEQVCS-CGSRATTFNSHTQAYACWKHCL----GFD 5700 Avian infecti...
YP_002308496 5327 WKVVRNEIATHLAE-VAPYTDHICFVTWAHQLELATMRYFVKIGTEESCF-CGRRA-CFTNETE-FTCKAHRAlsvpSCD 5402 Thrush corona...
P0C6X7       6061 WNVVRIKIVQMLSDTLKGLSDRVVFVLWAHGFELTSMKYFVKIGPERTCClCDKRATCFSTSSDTYACWNHSV----GFD 6136 Severe acute ...
5C8T_B        236 YVYNPFMIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIGDELRVNSACRKVQH 315 
Q98VG9       5785 YLYNPYCIDIQQWGYTGSLSMNHHEVCNIHRNEHVASGDAIMTRCLAIHDCFVKRVDWSIVYPFIDNEEKINKAGRIVQS 5864 Feline infect...
P0C6X1       5826 YVYNPYVIDIQQWGYVGSLSTNHHAICNVHRNEHVASGDAIMTRCLAVYDCFVKNVDWSITYPMIANENAINKGGRTVQS 5905 Human coronav...
P0C6X9       6216 YLYNPLIVDIQQWGYTGSLTSNHDPICSVHKGAHVASSDAIMTRCLAVHDCFCKSVNWNLEYPIISNEVSVNTSCRLLQR 6295 Murine hepati...
P0C6Y1       5701 FVYNPLLVDIQQWGYSGNLQFNHDLHCNVHGHAHVASVDAIMTRCLAINNAFCQDVNWDLTYPHIANEDEVNSSCRYLQR 5780 Avian infecti...
YP_002308496 5403 YVYNPFLIDVATWGFSGRLSTNHDEVCTYHSNAHVASADATMTVCLAIHELF-RSVDWDLEFPVTPEQSQLNKACRLVQA 5481 Thrush corona...
P0C6X7       6137 YVYNPFMIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIGDELRVNSACRKVQH 6216 Severe acute ...
5C8T_B        316 MVVKSALLADKFPVLHDIGNPKAIKCVpQAEVEWKFYDAQPCSDkayKIEELFYSYATHHDkfTDGVCLFWNCNVDRYPA 395 
Q98VG9       5865 HVMKAALKIFNPAAIHDVGNPKGIRCA-TTPIPWFCYDRDPINN---NVRCLEYDYMVHGQ--MNGLMLFWNCNVDMYPE 5938 Feline infect...
P0C6X1       5906 HIMRAAIKLYNPKAIHDIGNPKGIRCA-VTDAKWYCYDKNPINS---NVKTLEYDYMTHGQ--MDGLCLFWNCNVDMYPE 5979 Human coronav...
P0C6X9       6296 VMFRAAMLCNRYDVCYDIGNPKGLACV--KGYDFKFYDASPVVK---SVKQFVYKYEAHKDqfLDGLCMFWNCNVDKYPA 6370 Murine hepati...
P0C6Y1       5781 MYLNACVDALKVNVVYDIGNPKGIKCVrRGDVNFRFYDKNPIVR---NVKQFEYDYNQHKDkfADGLCMFWNCNVDCYPD 5857 Avian infecti...
YP_002308496 5482 NYLNILLTTTKATVVHDIGNPKGIPTVrRAGVKYHFYDQAPIVK---HVQKLKYKPEMEARf-MEGLTMFWNCNVDTYPA 5557 Thrush corona...
P0C6X7       6217 MVVKSALLADKFPVLHDIGNPKAIKCVpQAEVEWKFYDAQPCSDkayKIEELFYSYATHHDkfTDGVCLFWNCNVDRYPA 6296 Severe acute ...
5C8T_B        396 NAIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPC------EShgKQVvs-diDYVP 468 
Q98VG9       5939 FSIVCRFDTRTRSKLSLEGCNGGALYVNNHAFHTPAYDRRAFAKLKPMPFFYYDDSNC------ELvdGQP-----NYVP 6007 Feline infect...
P0C6X1       5980 FSIVCRFDTRTRSTLNLEGVNGGSLYVNNHAFHTPAYDKRAMAKLKPAPFFYYDDGSC------EVvhDQV-----NYVP 6048 Human coronav...
P0C6X9       6371 NAVVCRFDTRVLNKLNLPGCNGGSLYVNKHAFHTSPFTRAAFENLKPMPFFYYSDTPCvymegmES--KQV-----DYVP 6443 Murine hepati...
P0C6Y1       5858 NSLVCRYDTRNLSVFNLPGCNGGSLYVNKHAFYTPKFDRISFRNLKAMPFFFYDSSPC------ET--IQVdgvaqDLVS 5929 Avian infecti...
YP_002308496 5558 NALVCRYDTHRQK--HLIGPNGSALYINKHAFLTPEMHTYATHKLTLAPLIYYSTTDC------SS--EQP-------IV 5620 Thrush corona...
P0C6X7       6297 NAIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPC------EShgKQVvs-diDYVP 6369 Severe acute ...
5C8T_B        469 LKSATCITRCNLGGAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTR 526 
Q98VG9       6008 LKSNVCITKCNIGGAVCKKHAALYRAYVEDYNMFMQAGFTIWCPQNFDTYMLWHGFVN 6065 Feline infectious peritonitis virus...
P0C6X1       6049 LRATNCITKCNIGGAVCSKHANLYRAYVESYNIFTQAGFNIWVPTTFDCYNLWQTFTE 6106 Human coronavirus 229E
P0C6X9       6444 LRSATCITRCNLGGAVCLKHAEEYREYLESYNTATTAGFTFWVYKTFDFYNLWNTFTR 6501 Murine hepatitis virus strain A59
P0C6Y1       5930 LATKDCITKCNIGGAVCKKHAQMYAEFVTSYNAAVTAGFTFWVTNKLNPYNLWKSFSA 5987 Avian infectious bronchitis virus (...
YP_002308496 5621 VSYRDCVTRCNTGTTICPTHALEYQEFINAYNLMARHGFNVYIPRNVNVYNCWLSFTN 5678 Thrush coronavirus HKU12-600
P0C6X7       6370 LKSATCITRCNLGGAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTR 6427 Severe acute respiratory syndrome-r...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap