Conserved Protein Domain Family
PCAF_N

?
pfam06466: PCAF_N 
PCAF (P300/CBP-associated factor) N-terminal domain
This region is spliced out of human KAT2A isoform 2. It is predicted to be of a mixed alpha/beta fold - though predominantly helical.
Statistics
?
PSSM-Id: 399460
View PSSM: pfam06466
Aligned: 27 rows
Threshold Bit Score: 270.324
Threshold Setting Gi: 641664654
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001635907  14 RIAQRKAQVKTYPRRKKLEKLGVYSSCKVEDtCKCNGWKNpNPPPTp---PRLDLSQPLASLNDPCR--SCGHSLGLHIS 88   starlet sea an...
XP_001380514 105 RIAVKKAQLRSAPRAKKLEKLGVYSSCKAEEsCKCNGWKNpNPPPTp---PRADLQQIIVNLTESCR--SCSHALAAHVS 179  gray short-tai...
XP_015835856  52 RIQQKKQAVLAFPYNKKLLKLAIYSKCQSEN-CICTGWK------------KTDPNMQEPTFTDPCR---CEHPLEMHIS 115  red flour beetle
Q17PA5        43 RILQRKQRVYQLPKNQKLTKLSMYSACQGTE-CRCTGWKTpEEn-----rHKDVEVDYCPNFKEECRnpNCKHPLDMHIA 116  yellow fever m...
Q9VTZ1        73 RIQQRKQKVFNLPVPQKLAKLSMYSACQSEG-CRCTGWKTpQEn-----rHRDVESSYCPEFNEECRntSCRHSLRSHIA 146  fruit fly
3_pfamImport   1 -IFQRKQKVFNLPLEQKLAKISTFSACQTPE-CRCSGWKIpQEn-----rHRDIESDYCPDFGDECRtaACKHPLSSHIS 73  
XP_008183088  10 srqtdmpvVMTVPRMKKLIKISSYMPCRILS-CVCKRWI-------------CNEKLNAQSMISICDrsFCNHKLYDHVS 75   pea aphid
EDV26752      32 ksAQRKAYLKSYPKCKKLQKLAMYSSCRDKDsCSCTAWK----SNKdtstNDCATDSENAILLEACK--SCGHSLTSHIV 105  Trichoplax adh...
EFX74096       6 KIQLRKQQVREWPHPKKLEKLAVYSSCKFDEnCKCNGWKNpTTPPNvn-nTGINVVLPSANLTDPCR--SCSHNLSDHVS 82   common water flea
CDS41355      10 mlfeRRKYISSLTAEEKVPKVMPYIPCQQLD-CKCASWK------------------PCDNGEDAYRcaLCDH------H 64   Echinococcus m...
XP_001635907  89 QLQSISEDELDRLLC-----MVVDVENLFMCVHK-------EE-DADTK---QVYFYLFKLLRKCILQMSTPTVEGQLGT 152  starlet sea an...
XP_001380514 180 HLENVAEEEMNRLLG-----IVLDVEYLFTCVHK-------EE-DADTK---QVYFYLFKLLRKCILQMGKPVVEGSLES 243  gray short-tai...
XP_015835856 116 HLRSKTEDELNRLLR-----MVVDIDNMGTAMSR-------EE-NIETK---KVYTYLFHLLRKCILTLDTPVVESSLGQ 179  red flour beetle
Q17PA5       117 HLGEISEDQINELLG-----AIVDVENLYMSMLR-------ET-DTDTK---KVYAYLFRLLRQCILTRSQPVIRGPLGD 180  yellow fever m...
Q9VTZ1       147 HLDNISSSSMNELLG-----AIIDMENLFMSMQR-------VE-DEDTK---KVYQYLFRLLRQCVLTRQQAVIRGPLGD 210  fruit fly
3_pfamImport  74 HLSDITNEQMNEILG-----AIIDTENLFISMTK-------VE-DEDTK---KVYAFLFRLLRQCVASRQQPVVRGPVGD 137 
XP_008183088  76 HLVNAPENALDYLTI-----KIIEFENTNDKIEYllklpsdYErNAELKysnNVKGLLKHEIKYFI--NIDSSIEDLIEK 148  pea aphid
EDV26752     106 HLKHLDDDELGKLLS-----MTVDMDSIWVLVSN-------QHiDNDTK---QVYVYVYKLLRKCINSAIRPSLDTQLGK 170  Trichoplax adh...
EFX74096      83 HLINSSNEELNQLLS-----LVVDIENLFVCVNK-------EE-DPDNK---QVYFCLFKLLRKCIMQMTKPVVEGPLGS 146  common water flea
CDS41355      65 HFGDSSSPEFSSWIEdlavqMVEDLETLFLLCSN-------EE-DLETR---QLYFCMLKRLRKALANRTHPQVDDL--- 130  Echinococcus m...
XP_001635907 153 PPFEKPSIAKAVINFVLHKFGHLPQREWQIMHDLAKMFLHCLNHWKLETVAMRKQHA-EAEHIAAYKLNYTRWLCYCHVP 231  starlet sea an...
XP_001380514 244 PPFEKPSIEQGVNNFVQYKFSHLPSKERQTIVELAKMFLNRINYWHLETPSQRRQRS-PNDDVAGYKVNYTRWLCYCHVP 322  gray short-tai...
XP_015835856 180 PPFEKPCIHKAITNLLVYKFSHLAQQEWKTMYEVARILLHCLNTWEFPSPSSQKHIV-SPEEATVYKMEHMRWLVFCNVP 258  red flour beetle
Q17PA5       181 PPFEQPSISKAVTNFVLFKYSHLNPGELETMTEVAKTFLHCLNHWNFEAPSARK-DL-SHEDASNYKINYTRWLVFCHVP 258  yellow fever m...
Q9VTZ1       211 PPFETPCITKAVLSLVFYKYNHLSTPELQTMTEVAKTFLNFLNHYNFESPSTRRGDL-THEDASNYKINYTRWLVFCHVP 289  fruit fly
3_pfamImport 138 PPFETPSIAKAITNFVY-------STGTQAMTEVATTFIHFVNHWNFETPSQRKTDA-TAEDGSSYKINYTRWIIFCQVP 209 
XP_008183088 149 PPFESPAIADIFMHFCLYEYSY-NTDELQMAFYITRQILDHFNHWTWITPEKLPFLN-KLKFNNSYKFYYQKYKEHC-LP 225  pea aphid
EDV26752     171 PPFEQPTIERAVYNFTMLKFSNLKQAEWQIMHELAKMFLRCLNRWRIESPSARKARLnAQADDQIYKINYNRWLCFCHIP 250  Trichoplax adh...
EFX74096     147 PPFERLNISKGVTNFVMFKYSQQIPKEFQKMCDLAKMFIHCLNHWKLETPTQWKQHY-PQADLSVYRISYTRWLCYCNVP 225  common water flea
CDS41355     131 PPFERPSISTAVRNLIIQKLS-ITPSEALIYVDAGRLVLTYLNGHRLQVPKHRKQ---KNENLTGYRLIYMRWMCHCYIP 206  Echinococcus m...
XP_001635907 232 VFCD--SL-PKCDTTAVFGRTLLRSVFSVMRSQLLE 264  starlet sea anemone
XP_001380514 323 QFCD--SL-PRYETTQVFGRTLLRSVFTVMRRQLLE 355  gray short-tailed opossum
XP_015835856 259 TFCD--SL-KHYDTTMVFGRTLLRAVFKYMRKQIMD 291  red flour beetle
Q17PA5       259 AFCS--SL-RHFETSIVFGRTLLKAVYQYVYQQLLT 291  yellow fever mosquito
Q9VTZ1       290 AFCN--SL-RQCETSLVFGRTLLRTVFQCMSQQLKK 322  fruit fly
3_pfamImport 210 SFCN--SL-PHYETANVFGREFLRSVFKVIAQQINH 242 
XP_008183088 226 SFSNhsKLkPSYSSSTIFGKDILKYTLKVFRPsvtn 261  pea aphid
EDV26752     251 VLCD--SF-ERFNLISTFGRTFLRSVITTIKEQIIl 283  Trichoplax adhaerens
EFX74096     226 SYCD--SL-PQYETSAIFGRSFLRLVYSTVQRQLMD 258  common water flea
CDS41355     207 LFCT--TF-PYFEPTAAFGKNFFLALLPELKSGLLE 239  Echinococcus multilocularis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap