Conserved Protein Domain Family
DMAP_binding

?
pfam06464: DMAP_binding 
DMAP1-binding Domain
This domain binds DMAP1, a transcriptional co-repressor.
Statistics
?
PSSM-Id: 368923
View PSSM: pfam06464
Aligned: 20 rows
Threshold Bit Score: 57.0439
Threshold Setting Gi: 12230343
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001632323  726 NGTVLPDDVQKKLSQLTEEFKSGYLTEKGYNRKKNKILKKFLntpqime---hnntniSHYNrpnqtmTYntHHLMSHNT 802  starlet sea a...
Q3T906        699 NISLLPKDAQLSLNTLDLQLEHGDITLKGYNLSKSALLRSFLmn-------------sQHAKiknqaiITdeTNDSLVAP 765  human
EIW07524        5 IPPTLPLDLQSRLNELIQDYKDENLTRKGYETKRKQLLDKFEis-------------qMRPYtplrspNSrkSKHLHRRN 71   Saccharomyces...
EDO16936        5 IPPELPIALQNQLSNLIEDYKVENLTRKGYETKRNELLDKYT-------------------------------------R 47   Vanderwaltozy...
Q14689          9 EAAPLPAEVRESLAELELELSEGDITQKGYEKKRAKLLARYIpliqg-------idpsLQAEnr--ipGPs-QTTAAAPK 78   human
AAI25728        9 LLESLPAEVRESLAELELELSEGDITQKGYEKKRAKLLARYIpliqgiv--hgwvdpsLQAEnk--laGSs-QILITANK 83   tropical claw...
Q4SKU1         98 PEGTAPLE------------ATGDITQKGYEKKRLKLIREYIphagg-------megpMSHR------AP--LGPPSAAR 150  spotted green...
Q9Y2E4          7 EGMALPLEVRARLAELELELSEGDITQKGYEKKRSKLIGAYLpqppr-------vdqaLPQEr----rAP--VTPSSASR 73   human
Q9P265         12 AVAALPPEVRAQLAELELELSEGDITQKGYEKKRSKLLSPYSpqtqe-------tdsaVQKElrnqtpAPsaAQTSAPSK 84   human
Q4RXY8         10 TLSPL--------------VFKGDITQKGYEKKRTKLLAPYVihtpvepprqkdvqppAPSSssgqapPApsSSRYRERR 75   spotted green...
XP_001632323  803 RHLMSHKTRHLMSvLDWQEVEPHS-SHFQFTTLADSPRSLDQPTEDERFL 851  starlet sea anemone
Q3T906        766 QEKQVHKSILPNSlGVSERLQRLT-FPAVSVKVNGHDQGQNPPLDLETTA 814  human
EIW07524       72 TSLASSITSLPNSiDRRHSIYRVTtINSTSANNTPRRRSKRYTASLQSSL 121  Saccharomyces cerevisiae CEN.PK113-7D
EDO16936       48 NQQALLYASRNSTvSVSTNTREHNlSTRIILPSNKRFIDDNASYKSQDTF 97   Vanderwaltozyma polyspora DSM 70294
Q14689         79 QQK-SRPTASRDE-RFRSDVHTEA-VQAALAKYKERKM--PMPSKRRSVL 123  human
AAI25728       84 QQR-SRSTSSRDE-RFRSDVHTEA-VQAALAKYKERKM--PMPSKRRSAL 128  tropical clawed frog
Q4SKU1        151 FHR-RRTSGTRDE-RYRSDVHTEA-VQAVLARHVERKMAVPMPSKRRSLV 197  spotted green pufferfish
Q9Y2E4         74 YHR-RRSSGSRDE-RYRSDVHTEA-VQAALAKHKERKMAVPMPSKRRSLV 120  human
Q9P265         85 YHR-TRSGGARDE-RYRSDIHTEA-VQAALAKHKEQKMALPMPTKRRSTF 131  human
Q4RXY8         76 SRRAHRGGGTRDD-RYRSDIHTEA-VQAALAKHKEEKMALPMPTKRRSTY 123  spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap