Conserved Protein Domain Family
NADH5_C

?
pfam06455: NADH5_C 
NADH dehydrogenase subunit 5 C-terminus
This family represents the C-terminal region of several NADH dehydrogenase subunit 5 proteins and is found in conjunction with pfam00361 and pfam00662.
Statistics
?
PSSM-Id: 368917
View PSSM: pfam06455
Aligned: 76 rows
Threshold Bit Score: 95.3101
Threshold Setting Gi: 74960533
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O63620 457 YSARIITSTFSQAGTLNPINPISEELNSLTNPLKRLAAGTTIAGWALLPLLLPAHSISPTPLWLKTAALTVTLIGLITAA 536 Balanoglossus carnosus
Q9T9N5 395 YSLRLSFLMLWSSYNQPPTSNVTDSNKNVYSPMTTLSIGAIVGGAIMQWSLSENFSPPTSPMLLTVSPSIPLISGLILGA 474 Terebratulina retusa
Q953X4 385 YCLRLSYYLVCGSLGSPSVLCYGDSDKDGLFPMIVLVLGSLVGGSVFSRVLVP-----NFSVVCNWGGFLAPVVSLFMGV 459 Terebratalia transversa
Q9TB51 388 YSTRFSVYVLMN-HTCSPSAQYSSEGVTQSFSVIVLAILAITGGAFTNWMFIMPVCEPNFSSGAKALAPLMVITGIILGI 466 Dumeril's clam worm
Q956D3 395 YSLRILLMAVFGQNFGGSLLSFGVESGYMVISILILAVGAISGGCLLQGVWVYVNGFDVVGVLGKAVIAFVTFIGLSYGV 474 Pronodularia japanensis
Q8M2C4 390 YTVRLCYYLMYNNYNFNSFSNLNDQGLIMLRGMFGLIFLVIITGSVLSWLLFSTPYFICLSLFMKMMTLLMISIGILFGL 469 Pyrocoelia rufa
Q8WB27 389 YSFRLTMYLMINDYNLLSIYNLYDEDFIMLKSMMILLFMSVISGSFLMWLIFSYPYMIFLPFNMKMMVIYVSILGVFMGF 468 Asian corn borer
Q9MIE7 389 YTFRLIMYVMINDFNLMMIYNLYDEDYIMLNSMFVLLFMSLLSGSFLSWFIFSYPYMIYLPFNLKLMVIYVSILGSILGF 468 domestic silkworm
O63307 170 YTMRLLMYMMVNEFNLLSTYCLYDEDLVMLKSMMMLLLMSLISGSLLSWLIFNYPYMIYLPFNLKLMVIYVSLMGMLFGL 249 common grass yellow
Q8HQC4 388 YTIRLLMYLMVNDFNLVVIYNLYDEDYVMLKSMMILLMMSLISGSFLSWMIFYYPYMIYLPFSLKMMVIYVSFLGLIMGY 467 Pierre's acraea
O63620 537 NLSTVINSPTAQAHTSllgSIRSFLTSFWHFPETIHLLQSNSWLSTGQTLTTRiFDRGWGEQVGAQGLGSINSLMSTQIQ 616 Balanoglossus carnosus
Q9T9N5 475 LLVLFSYSNPPSKA-----PMAFFLTSMWHLKDLTSLPINLSSLILSNNSKNL-LDHGWNEIMTAKGTQKTLTETSNPSS 548 Terebratulina retusa
Q953X4 460 YLAGVLLKFPGGVGGGg--KSESFWGGLWFLGDLASKPVSVVVMSVSGTMLKS-CDQGWVEHMTSKSFERVFYTASGLML 536 Terebratalia transversa
Q9TB51 467 IASLSSTNSKS--------FIITSHCFMWFLTPLSTHFMPKLTMILPFMELKE-TDQGWS--LIPSLMMEQLMSQSHPII 535 Dumeril's clam worm
Q956D3 475 VGYLSVWKFGRVLVG----SLGRFLSSMWFMNMVSGSLVAGVGLKWGVLLHLQ-LDQGWMEVFGGQGVFGALKKGGYRFP 549 Pronodularia japanensis
Q8M2C4 470 VFEYLI------NMKFkymKSLFFFSSLWNLSSLSTFGVNPFPLKLSGLYYKT-IDQGWSEYFGVNGLYKIMLSNSSLLM 542 Pyrocoelia rufa
Q8WB27 469 IISNMNIYSVNKFLMTy--QISNFLCLMWFMPNLSTYGLNFYFLNFGQMMLKN-IDMGWSEMYSGQGMFFIMKKYSILFN 545 Asian corn borer
Q9MIE7 469 MVSNMGIYSLNKLLLSy--NLSSFLCLMWFMPNLSTYGLSYIYLNFSQILFKN-IDMGWSEIYSGKGIFNILKNYSVFYN 545 domestic silkworm
O63307 250 LMSMMNLYSVNKFILTy--ELSMYLSTMWFMPNLFTYGLNFKLLSLGQNLMKS-IDLGWSELYSGQGIFSILKNYSIIFN 326 common grass yellow
Q8HQC4 468 LISNMSIYSLNKFMMTy--NLSYFFVSMWFLPSLSTYGLNYYFLNFSQKLFKN-IDLGWSEYYSGQGIYSIVKDNSVVYY 544 Pierre's acraea
O63620 617 ATQSGLIKQYIAVAILSLLLIALIA 641 Balanoglossus carnosus
Q9T9N5 549 STEKSPLPSILLTTGAVMLIPMILQ 573 Terebratulina retusa
Q953X4 537 TSQVSSLKSSVLFLGGCVLGVLVFG 561 Terebratalia transversa
Q9TB51 536 NAQDNSMMTHLACVLFLIIWALLMT 560 Dumeril's clam worm
Q956D3 550 MWCSGA--------GCWCLLVFLLF 566 Pronodularia japanensis
Q8M2C4 543 ILITNSLKIYLLLFVIFIYLIFLYI 567 Pyrocoelia rufa
Q8WB27 546 LFSMKNYKIYLFSFVLWMFMLIILM 570 Asian corn borer
Q9MIE7 546 IYQMNNFKIYLFSFILWFMILFIFF 570 domestic silkworm
O63307 327 ILQMNNFKIYMYSFVLWMLFMLFFN 351 common grass yellow
Q8HQC4 545 VYQMNNFKIYLFSFILWVLFMIMLI 569 Pierre's acraea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap