Conserved Protein Domain Family
LT-IIB

?
pfam06453: LT-IIB 
Type II heat-labile enterotoxin, B subunit (LT-IIB)
Family of B subunits from the type II heat-labile enterotoxin. The B subunits form a pentameric ring, which interacts with one A subunit. Thus, the structural arrangement of type I and type II heat-labile enterotoxins are very similar.
Statistics
?
PSSM-Id: 115129
View PSSM: pfam06453
Aligned: 2 rows
Threshold Bit Score: 240.33
Threshold Setting Gi: 1169448
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ALP46911   1 MSSKKIIGAFVLMTGILSGQVYAGVSEHFRNICNQTTADIVAGVQLKKYIADVNTNTRGIYVVSNTGGVWYIPGGRDYPD 80  Escherichia phage R...
P43529     1 MSFKKIIKAFVIMAALVSVQAHAGASQFFKDNCNRTTASLVEGVELTKYISDINNNTDGMYVVSSTGGVWRISRAKDYPD 80  Escherichia coli
ALP46911  81 NFLSGEIRKTAMAAILSDTKVNLCAKTSSSPNHIWAMELDRE 122 Escherichia phage Rac-SA53
P43529    81 NVMTAEMRKIAMAAVLSGMRVNMCASPASSPNVIWAIELEAE 122 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap