Conserved Protein Domain Family
Hepcidin

?
pfam06446: Hepcidin 
Hepcidin
Hepcidin is a antibacterial and antifungal protein expressed in the liver and is also a signaling molecule in iron metabolism. The hepcidin protein is cysteine-rich and forms a distorted beta-sheet with an unusual disulphide bond found at the turn of the hairpin.
Statistics
?
PSSM-Id: 399449
View PSSM: pfam06446
Aligned: 18 rows
Threshold Bit Score: 27.3656
Threshold Setting Gi: 1043406052
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003450578  37 GSNDTPVVAHQEMSAESSMMSNHIRQKRQSHLSLCRWCCNCCrSNKGCGFCCR 89  Nile tilapia
XP_025767403 122 KSTDDPAATQEETSVETWMMPFDIGENGDASPVRCRHCCDCC-LLSGCGICCQ 173 Nile tilapia
XP_005808614  37 GGNDTPVEAHQEVSMESWMMPKHVREKRQSHLSLCRYCCNCC-KNKGCGFCCR 88  southern platyfish
P61516        43 QENQH-LTEAEHRQTDPLVL---FRTKRQSHLSLCRFCCKCC-RNKGCGYCCK 90  zebrafish
OCA18734      31 KAPEHPISESEQGESDALGPL--FRTKR--HLNICVYCCKCCkKQKGCGMCCF 79  tropical clawed frog
1_pfamImport   1 MSVEFPLAEQEETSVDSWKMPYNIREKRGIK---CKFCCGCC-TPGVCGLCCR 49 
XP_025767403  34 MSMDYPAAAPEQILVDSWKKLYNTIHRPGIK---CRFCCGCC-TPGICGICCS 82  Nile tilapia
XP_004085457  37 LTDDSPPAADQKIPVTSWKTLYDIRNKRDASAAGCRFCCGCC-GMSGCGVCCP 88  Japanese medaka
XP_003979568  37 VMDDNGAAVYEEMPVDSWKMPYTNRHKR--SPKRCKFCCNCCpGMSGCGVCCR 87  torafugu
CAG07920      37 VIDDDVAAAYEEISDDSWKTPYTNRHKR--SPAGCRFCCGCCpRMRGCGVCCK 87  spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap