Conserved Protein Domain Family
DNA_pol3_theta

?
pfam06440: DNA_pol3_theta 
DNA polymerase III, theta subunit
DNA polymerase III (EC 2.7.7.7) is comprised of three tightly associated subunits, alpha, epsilon and theta. This family contains the theta subunit. The structure of the theta subunit shows that the N-terminal two thirds is comprised of three helices while the C-terminal third is disordered. The function of the theta subunit is poorly understood, but the interaction of the theta subunit with the epsilon subunit is thought to enhance the 3' to 5' exonucleolytic proofreading activity of epsilon.
Statistics
?
PSSM-Id: 399446
View PSSM: pfam06440
Aligned: 15 rows
Threshold Bit Score: 85.8789
Threshold Setting Gi: 500706164
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8D2Y6               5 TLNLFKISKKNREKIMVDLASSGVVFRERYNMPVSIEQIENNQPEYLLSYFRKRLIYYRIISKKLKKS 72  Wigglesworthia glossi...
WP_011977779         3 KWNIASFSKEEQDKVAVDKVAAAVAWQERMNKPVVPELVEREQPEHLREYFHERLRVHRLNSQQLPRA 70  Enterobacterales
WP_013317820         2 GYNLAELPYEEMEKVNVDLAASGVAFRERYNMPVIPDEIEQQQPAHLRTYFRERVSYYREMSRQFSTL 69  Dickeya dadantii
CBJ81682             2 VHNLAKLSKDEMDKVNVDLVASGVAFKERYNMPVIPDTVEQSQPQHLREYFRQRLSHYREQSRYFSRL 69  Xenorhabdus bovienii ...
Q7N3M5               2 KHNLAELSTENMDKVNVDLAASGVAFKERYNMPVLPDTVEQEQPEHLRQYFQQRLVHYRQLSKQLSNL 69  Photorhabdus laumondi...
wugsc:CKO_01124     12 QTNLAQLEQADMDKINVDLAAAGVAFKERYNMPVVAEVVEREQPEHLREWFRERLIAHRLASVSLSRL 79  Citrobacter koseri AT...
goetting:EBL_c23050  3 NYNLADLPQEEMDKVNVDLAAAGVAFKERYNMPVIADQVELEQPAALRGWFRERLIAHRLASVNLSRL 70  Shimwellia blattae DS...
Q2NTH6               2 EYNLAALDEAKRDKINVDLAASAIAFKERYNMPVVAEQVEREQPAPLREYFRARVAFYRQASLNLSRL 69  Sodalis glossinidius ...
ACR68881             2 SFNLATLPQAQMDRINVDLAASGISYKERYHMPVIAEQVEREQPEALRSYFRERLQYYR--TLTLPTL 67  Edwardsiella ictaluri...
CAL20423             2 GYNLVELSDEETAKMNVDLAASGVAFKERYNMPVIPEMVAREQPEALREYFLQRLAHYRIESKKLSRL 69  Yersinia pestis CO92
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap