3W8O,4JET


Conserved Protein Domain Family
HasA

?
pfam06438: HasA 
Click on image for an interactive view with Cn3D
Heme-binding protein A (HasA)
Free iron is limited in vertebrate hosts, thus an alternative to siderophores has been developed by pathogenic bacteria to access host iron bound in protein complexes. HasA is a secreted hemophore that has the ability to obtain iron from hemoglobin. Once bound to HasA, the heme is shuttled to the receptor HasR, which releases the heme into the bacterium.
Statistics
?
PSSM-Id: 399444
View PSSM: pfam06438
Aligned: 4 rows
Threshold Bit Score: 252.14
Threshold Setting Gi: 576864826
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3W8O_B   3 MSISISYSTTYSGWTVADYLADWSAYFGDVNHRPGQV-VDGSNTGGFNPGP--FDGSQYALKSTASDA-AFIAGGDLHYT 78  Pseudomonas aeruginos...
Q4K5N8   1 MSISISYSATYGGNTVAQYLTDWSAYFGDVNHRPGEV-VDGTNTGGFNPGP--FDGTQYAIKSTASDA-AFVADGNLHYT 76  Pseudomonas protegens...
4JET_B   1 MSTTIQYNSNYADYSISSYLREWANNFGDIDQAPAET----KDRGSFSGSStlFSGTQYAIGSSHSNPeGMIAEGDLKYS 76  Yersinia pestis
Q6D6Z2   1 MSFAITYDAYYANYSIANYLTEWSAAFGDVNHTTGNTqVGGNNTGGFYGGDtfIDGSQYAITSTQNDFsALIAGGDLTYS 80  Pectobacterium atrose...
3W8O_B  79 LFSNPSHTLWGKLDSIALGDTLTGGASSg--GYALDSQEVSFSNLGLD------SPIAQGRDGTVHKVVYGLMSGDSSAL 150 Pseudomonas aeruginos...
Q4K5N8  77 LFSNPSHTLWGSVDTISLGDTLAGGSGS---NYNLVSQEVSFTNLGLN------SLKEEGRAGEVHKVVYGLMSGDSSAL 147 Pseudomonas protegens...
4JET_B  77 FM--PQHTFHGQIDTLQFGKDLATNAGGpsaGKHLEKIDITFNELDLSgefdsgKSMTENHQGDMHKSVRGLMKGNPDPM 154 Yersinia pestis
Q6D6Z2  81 LFSPPAHTLYGDLDSLSFGNVLQGGTTAg-tTYSLVEPEVTFSGLDLStd---vANLTVSDRGVVHDVIYGLMGGQVQPL 156 Pectobacterium atrose...
3W8O_B 151 QGQIDAllKAVDpslsINSTFDQLAAAGVAhATPAA 186 Pseudomonas aeruginosa PAO1
Q4K5N8 148 AGEIDAllKAIDpslsVNSTFDDLAAAGVAhVNPAA 183 Pseudomonas protegens Pf-5
4JET_B 155 LEVMKA--KGIN----VDTAFKDLSIASQY-PDSGY 183 Yersinia pestis
Q6D6Z2 157 LDALTN--AGID----INASLDSLSFAT---ATSDA 183 Pectobacterium atrosepticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap