4C3B


Conserved Protein Domain Family
Pneumovirus_M2

?
pfam06436: Pneumovirus_M2 
Pneumovirus matrix protein 2 (M2)
This family consists of several Pneumovirus matrix glycoprotein M2 sequences. This family functions as a transcription processivity factor that is essential for virus replication.
Statistics
?
PSSM-Id: 399442
View PSSM: pfam06436
Aligned: 3 rows
Threshold Bit Score: 221.088
Threshold Setting Gi: 123840724
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4C3B_A  34 EWPPHALLVRQNFMLNRILKSMDKSiDTLSEISGAAELDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNS 113
Q2Y2M2  29 SWPDRYLLLRSNYLLNQLLRNTDRS-DGLSLISGAGRDDRTQDFVLGSTNVVQNYIDNNENITKASACYSLYNIIKQLQE 107 Avian metapneumovirus...
O42050  29 EWPPHALLVRQNFMLNKILKSMDKSiDTLSEISGAAELDRTEEYALGIVGVLESYIGSINNITKQSACVAMSKLLIEINS 108 Human respiratory syn...
4C3B_A 114 DDIKKLRDNEELNSPKIRVYNTVISYIESNrKNNKQTIHLLKRLPADVLKKTIKntLDIHKSITINNPKESTVSD 188
Q2Y2M2 108 TDVRQARDNKVDDSKHVALHNLVLSYMEMS-KTPASLINNLKKPPKEKLKKLAK--LIIELSAGVENDSTAAMQD 179 Avian metapneumovirus 15a
O42050 109 DDIKKLRDNEEPNSPKIRVYNTVISYIESNrKNNKQTIHLLKRLPADVLKKTIKntLDIHKSIIISNPKESTVND 183 Human respiratory syncytia...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap