4FAV


Conserved Protein Domain Family
Me-amine-dh_H

?
pfam06433: Me-amine-dh_H 
Click on image for an interactive view with Cn3D
Methylamine dehydrogenase heavy chain (MADH)
Methylamine dehydrogenase (EC:1.4.99.3) a periplasmic quinoprotein found in several methyltrophic bacteria. Induced when grown on methylamine as a carbon source MADH catalyzes the oxidative deamination of amines to there corresponding aldehydes. MADH is a hetero- tetramer, comprised of two heavy chains (H) and two light chains (L). The H-chain forms a beta-propeller like structure.
Statistics
?
PSSM-Id: 399440
Aligned: 2 rows
Threshold Bit Score: 682.849
Threshold Setting Gi: 459358701
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4FAV_F  42 DARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPT 121 Paracoccus denitrific...
Q50420  59 DAKRVYVLDPGHFHVTTTVYTIDGNKNNLLGMTDTGKLANVMLSSDGKFFVTSNTTYSRIARGKRDDYVEVIDAQSHKVL 138 Methylobacillus flage...
4FAV_F 122 ADIELPDApRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLA 201 Paracoccus denitrific...
Q50420 139 ADIDIPEG-RFLTGVMNRMASLSTDNKYMLFQQFAPSPAVGLVDLEKKSFVKMMDIPDCYQIFPVPNQSFYMHCRDGSLQ 217 Methylobacillus flage...
4FAV_F 202 KVAFGTEGTPE-ITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGG 280 Paracoccus denitrific...
Q50420 218 QFGYDDKGNLKpMKPTKVFHGEDDYLFVNPYYSNGSGRLVWPTYEGRIFQAKLTDKKVDFMKPFELFTEAEKKANWRPGG 297 Methylobacillus flage...
4FAV_F 281 WQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDA 360 Paracoccus denitrific...
Q50420 298 WQVVAYHKARNEIYVLADQRAKWTHVTASRYVFVVDGTTGKRLRRIDLGHEIDGISVTQDANPNLYAVSAEAKTLFTFNA 377 Methylobacillus flage...
4FAV_F 361 ESGEELRSVNQLGHGPQVITTAD 383 Paracoccus denitrificans PD1222
Q50420 378 VTGKETGKVDELGRAPTISLTMD 400 Methylobacillus flagellatus KT
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap