Conserved Protein Domain Family
L_lactis_RepB_C

?
pfam06430: L_lactis_RepB_C 
Lactococcus lactis RepB C-terminus
This family consists of the C-terminal region of RepB proteins from Lactococcus lactis (See pfam01051).
Statistics
?
PSSM-Id: 399438
View PSSM: pfam06430
Aligned: 7 rows
Threshold Bit Score: 178.427
Threshold Setting Gi: 510932264
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_016252713 246 KKFVAPIDYKDEqaDEAYLAKKEQDTQNNQALYTVAMTNPYTQMLLKLFLLDALELTDMDLMIGLQKNVYPLYDKLKELR 325 Enterococcus su...
EKN67425      95 KRKADDNSYKLD--DRAYQEDKARKAETEDMLTVQALKSPYTKLLMEHFLLSYLDLTDTKILSGLQAHVYPLYDELKDLR 172 Bacillus batavi...
WP_057811736 260 NQVADDISYKLD--DPVYIDGKIRQEESEKDLVYEAMKSPYTKLLMEHFLLSYIDLTDTAILSGLQKNVYPLYDELKELR 337 Lactobacillus s...
CEN29556     266 QE--LNGEYKIReqDPAYLQGKADRELNQQTLFAEAMQSKYTMELITSTLLSPVEMTDITLMANLQQEVYPLYKELEEIV 343 Lactococcus pis...
EKN67048      21 KPVAKNENYKEEqqDTVYLQTKADREAKQKMLFAEAMQSPYTKLLGEKWLINVADMQDISTMTGLAEKVYPLYDELKEAR 100 Bacillus azotof...
KRK45067       1 MG------------DKDYQADKKQKSRNEADLLKQAMESKYTRLLSENFLIGMNDIMDTATMVGLQKNVYPLYDELKELR 68  Lactobacillus a...
KRK45065     259 KRRADDNSYKLE--DTAFQVDKKQKEQSEAVLVKQAMESKYTRLLIENFLLSPLEMTDTALMAGLQKNVYPLYDELKELR 336 Lactobacillus a...
WP_016252713 326 GLKGVDKHLSYVTAKQTAFSKTNVAKYLHKSIKQYLVQVKIEDQ 369 Enterococcus sulfureus
EKN67425     173 GLNGVKDHLSYVGAKQEDYSKKNICKYLKKAIEHYLPTVKRQDL 216 Bacillus bataviensis LMG 21833
WP_057811736 338 GLKGVKEHLAYIRDKQDDYSKKNIAKYLKKSIEQYLPIVKRQDI 381 Lactobacillus siliginis
CEN29556     344 GLKGVRKHLEYVSNKKLDYSKPNLVKYLKTAVMRYIDSG---DI 384 Lactococcus piscium MKFS47
EKN67048     101 GLKGVETHLSYVASKQEGYSKRNVVKYLKTAIEGYLPTVALQDL 144 Bacillus azotoformans LMG 9581
KRK45067      69 GLNGVKDHLSYVASKQEAYSKRNVAKYLKKAIEQYLPTVKRQDL 112 Lactobacillus algidus DSM 15638
KRK45065     337 GFEGVKKHLSYVHDKQEPYSKGNIAKYLKKAIDQYLPTVKLQDL 380 Lactobacillus algidus DSM 15638
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap