Conserved Protein Domain Family

pfam06422: PDR_CDR 
CDR ABC transporter
Corresponds to a region of the PDR/CDR subgroup of ABC transporters comprising extracellular loop 3, transmembrane segment 6 and linker region.
PSSM-Id: 399433
Aligned: 446 rows
Threshold Bit Score: 79.4277
Threshold Setting Gi: 384496218
Created: 21-May-2020
Updated: 7-Aug-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
XP_003289144  708 dPN-----STVYNd--VNYRVCPTSAATPGQTTFTGESYLKNVINIQNS-LA---------------LNVCVVYVFVFLY 764  Dictyostelium...
EPB85957      713 VPF-----GPSYQd--WNYKVCTMTGGNPGENFVRGDDYLRAALSYNPKDLWa--------------pDFVVVVAFFIFF 771  Mucor circine...
EIE86709      700 IPY-----GPGYDd--WNYKVCTMQGGIPGQAYVQGDAYLLAALDYKPWQLWa--------------pDFVVVVGFFLFF 758  Rhizopus dele...
EIE78276      704 IPS-----GPGYDd--WNYKVCTMQGGTSGNPNVLGDDYLIEALDYKPWQLWa--------------pDFIVVVAFFLFF 762  Rhizopus dele...
EIE90933      688 VPY-----GPGYDd--WNYKTCTMAGGRPGSSFVAGDDYLNDYLSYKPEQMWa--------------pDFIVVIAFFLFF 746  Rhizopus dele...
EPB81631      707 IPY-----GPGYDd--WNYKVCTMAGGKPGNNYVLGDDYLNDYLSYNPSQMWa--------------pDFIVIIAFFLLF 765  Mucor circine...
EPB92868      721 VPY-----GPGYDl--WDYKVCTMTGGHPGQNFVLGDDYLITKLQWDTKHLWa--------------pDFIAVVGFFLLF 779  Mucor circine...
EIE83083      976 IPS-----GPGYDd--WSYKVCTMKGGVPGQPFVVGDDYLHQALSYNPSYLWa--------------pDFVVIVAFFILF 1034 Rhizopus dele...
EPB86778       19 VPScsdyiAP-------AYRICILPGAKPSDSFILSNDYLAQQYEQYTSQIW---------------IDFVAAVLFFVLF 76   Mucor circine...
CCD52338      771 MAAYLLVMTHISMEKMNGEILLFQRGHKPLHK 802  Botrytis cinerea T4
XP_003289144  765 IIVNCFIMEHFDMANGGFTSKVYKRGKAPKIN 796  Dictyostelium purpureum
EPB85957      772 TILTALAMEYVKLNKAGSLTKLYLPGKAPKPR 803  Mucor circinelloides f. circinelloides 1006PhL
EIE86709      759 TFMTALAMEWGGMSKASSLTKLYLPGKAPKPR 790  Rhizopus delemar RA 99-880
EIE78276      763 TLLTALAMEWGGMSKAASLTRLYLPGKAPRPR 794  Rhizopus delemar RA 99-880
EIE90933      747 TALTAIMMEFGGLSKAGTVTKLYLPGKAPKPR 778  Rhizopus delemar RA 99-880
EPB81631      766 TVMTAGAMELVGLSKSGTLTKLYLPGKAPKPR 797  Mucor circinelloides f. circinelloides 1006PhL
EPB92868      780 TALTALAMEFRTVSKIGSLTKLYVPGKAPKAR 811  Mucor circinelloides f. circinelloides 1006PhL
EIE83083     1035 TVLTALSMEYVKLNKSSTLTKLYIPGKAPKTR 1066 Rhizopus delemar RA 99-880
EPB86778       77 TALTALCMEYVDLKQEGTITKLYKKDTSPQVE 108  Mucor circinelloides f. circinelloides 1006PhL
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap