3NVA


Conserved Protein Domain Family
CTP_synth_N

?
pfam06418: CTP_synth_N 
Click on image for an interactive view with Cn3D
CTP synthase N-terminus
This family consists of the N-terminal region of the CTP synthase protein (EC:6.3.4.2). This family is found in conjunction with pfam00117 located in the C-terminal region of the protein. CTP synthase catalyzes the synthesis of CTP from UTP by amination of the pyrimidine ring at the 4-position.
Statistics
?
PSSM-Id: 399429
Aligned: 399 rows
Threshold Bit Score: 314.281
Threshold Setting Gi: 667638643
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3NVA_B         4 KYIVVTGGVLSSVGKGTLVASIGMLLKRRGYN-------------VTA----VKIDPYINVDA---GTMNPYMHGEVFVT 63  Saccharolobus s...
ENH76772       2 RYVLVSGGVISGVGKGIIASSTGLLLKTLGLR-------------VTS----IKIDPYLSVDA---GLMAPAEHGECFVL 61  Colletotrichum ...
XP_009657891   2 KYLLVSGGVISGPLRRAFCSSPAATEVSQSAKslilydfvidlllVTS----IKIDPYLGVDA---GLMSPLEHGECFVL 74  Verticillium da...
EGR45659       2 RYILVSGGVISGVGKGIIASSTGLLLKTLGLR-------------VTC----IKIDPYLNIDA---GTMNPKDHGECFVL 61  Trichoderma ree...
XP_007826518   2 RVVLVSGGVISGVGK---ASSSGLLLKTLGLR-------------VTSktprLLSDP-LTIQT---SADRSIRHGECFVL 61  Metarhizium rob...
CCE33729       2 RVVLVSGGVISGVGKGIIASSAGLLLKTTGLR-------------VTA----IKIDPYLNMDA---GTLGPLEHGECFVL 61  Claviceps purpu...
EEU44283       2 KYVLVSGGVISGIGKGIIASSSGLLLKTAGLK-------------VTA----IKIDPYLNQDA---GTLGPLEHGECFVL 61  [Nectria] haema...
EEU42830       2 KYVLVSGGVISGIGKGIIASSSGLLLKTLGLK-------------VTA----VKIDPYLNIDAgdqGTMSPKEHGECFVL 64  [Nectria] haema...
XP_009228850   2 KYIVVNGGVISGVGKGIIASSTGLLLKSIGLK-------------VTA----IKIDPYLNVDA---GTMNPLEHGECFVL 61  Gaeumannomyces ...
EMD63926       2 KYVLVSGGVISGVGKGIIASSTGLLLKTIGLK-------------VSS----IKVDPYLNVDA---GTMNPKEHGEVFVL 61  Bipolaris sorok...
3NVA_B        64 EDGAETDLDLGHYERFMDVNMTKYNNITAGKVYFEVIKKER----EGKYLGQTVQIIPHVTDQIKDMIRYASki------ 133 Saccharolobus s...
ENH76772      62 QDGMEVDLDLGNYERYLNIRLTGEHNITTGKVYRHVIEKER----RGDYLGKTVQVVPHVTDAIQDWIERVAkiptddsg 137 Colletotrichum ...
XP_009657891  75 DDGGETDLDLGNYERYLSIKLTKAHNITTGKIYKHVIEKER----RGDYLGKTVQVVPHITDGIQKWIEDVAkipvdesg 150 Verticillium da...
EGR45659      62 DDGGECDLDLGHYQRYLGINLSRDHNITTGKINLEVGLRER----RGDYLGKTVQVVPHVTNLIQEWIERVAripidesg 137 Trichoderma ree...
XP_007826518  62 ADGGETDLDLGNYERYLGIQLSNESNMTTGKIYKLVLDKER----RGDYLGKTVQVVPHITDAMQEWIERVAkipvddsg 137 Metarhizium rob...
CCE33729      62 ADGGESDLDLGNYERYLGIQLSRDNNITTGKIYHEVISRER----KGTYLGRTVQVVPHITDMIVEWITRVAkvpvddsg 137 Claviceps purpu...
EEU44283      62 K-GKESDLDLGNYERYLGLNLTKESNITTGKIYKAVLERER----RGDYLGRTVQVVPHVVNEIMDWVERVAkipvdesg 136 [Nectria] haema...
EEU42830      65 NDGGESDLDLGNYERYLGLNLTKESNITTGKIYNH---REAdkfcKGTYLGKTVQVVPHVVNAIQDSIERVAripvddsg 141 [Nectria] haema...
XP_009228850  62 SDGGEVDLDLGNYERYLNVNLTRGHSVTTGQIYKEVIDKER----KGDFLGKTVQIVPHITNAIQERIERVAripiddsg 137 Gaeumannomyces ...
EMD63926      62 SDGGEVDLDLGNYERYLNITLTRDNNITTGKIYQHVIERER----KGDYLGKTVQVVPHITDAIQEWIQRVAripvddsg 137 Bipolaris sorok...
3NVA_B       134 nnAEITLVEI---------GGTVGDIESLPFLEAVRQLKLEEGEd---NVIFVHIALVEYLSvtGELKTKPLQHSVQELR 201 Saccharolobus s...
ENH76772     138 eePDVCIIEL---------GGTVGDIESMPYVEALTQLRHRAGSg---NFIQIHVSYVPTIH--GEQKTKPTQHAVKTVR 203 Colletotrichum ...
XP_009657891 151 lePNVCIIEL---------GGTVGDIESMPFVEALVQLRHRAGRg---NFVNIHVSYVPVIG--QEQKTKPTQHAVKSVR 216 Verticillium da...
EGR45659     138 aePDVCIVEL---------GGTVGDIENMPFVEALTQLRHRIGKn---NFVNIQVSYVPVIN--GEQKTKPTQHAVKSIR 203 Trichoderma ree...
XP_007826518 138 eepDVCIS---------------IDMESAPFLEALVRLRYRLGRe---NFFSIAVSYVPIIN--GEEKTKPTQNAIREMR 197 Metarhizium rob...
CCE33729     138 eePDVCIIEL---------GGTVGDIESAPFVEALVQLRHKLSRdpnsSFFNIQVSFVPLIH--GEEKTKPTQHAIKQMR 206 Claviceps purpu...
EEU44283     137 eePDVCIVELvc-----prGGTVGDIESMPFVEALTQFRHKVGRg---NFINIHVSYVPIIH--GEEKTKPTQHAIKTMR 206 [Nectria] haema...
EEU42830     142 dePDVCIVPLltmsklswyGGTVGDIESMPFVEALTQFRQRAGKg---NFVNIHVSYVPVIH--GEEKTKPTQHSIRGAR 216 [Nectria] haema...
XP_009228850 138 eePDVCIIEL---------GGTVGDIESMPFVEALTQLRHRYGRn---GFFSIHVSFVPLIH--GEQKTKPTQHSVKTVR 203 Gaeumannomyces ...
EMD63926     138 eePDVCIIEL---------GGTVGDIESMPFVEAMSQLRRRAGKn---NFMQIHVSYVPVIH--GEQKTKPTQQAIKAVR 203 Bipolaris sorok...
3NVA_B       202 RIGIQPDFIVGRATLPLDDETRRKIALFTNVKVDHIVSSYDVETSYEVPIILESQKLVSKILSRLKL 268 Saccharolobus solfataricus
ENH76772     204 SYGLIPDLIACRCEQPLMEPTIRKIALLCQVDVPQVLVVRDMPTIYQVPLLLSEQGLIPWLRKAFNL 270 Colletotrichum orbiculare MA...
XP_009657891 217 SAGLIPDLVACRCELPLDDATVAKIAHHCQVDLEQVVAVRDMETIYQVPMLLHEQGLTTSLRSFLRL 283 Verticillium dahliae VdLs.17
EGR45659     204 SAGLIPDLIACRCERPLEPDTIKKIALHCQVETEQVIAVRDMPTVYQVPLLLKEQGLSDVLGVLLAL 270 Trichoderma reesei QM6a
XP_007826518 198 KAGLIPDMVACRCERELDDGTIQKIARSCQVEYEQVIGVRDMETIYQVPLLLEQEGLLKQLRKGLAL 264 Metarhizium robertsii ARSEF 23
CCE33729     207 SAGLIPDLIACRCDTTLVDGTIRKIASSCQVDYEQVIGVHDMETVYQVPLLLHEQGLLQRLTSGLEL 273 Claviceps purpurea 20.1
EEU44283     207 SAGLIPDLIACRCERALHHATVDKIARSCQVEDEQVITVRDIESIYQVPKLLEEQGLRDRLAEGLML 273 [Nectria] haematococca mpVI ...
EEU42830     217 QAGLLPDLIACRCERPPHEATVAKIASSCHVDMEQVIAVRDMETVYQVPHLLMTEGLLQQLKTGLQL 283 [Nectria] haematococca mpVI ...
XP_009228850 204 SAGLIPDLLCCRCETGLEKGTVNKIALHCQLEPEQVLVVHDMPSIYQVPMLLHEQGLIPLLETSMGL 270 Gaeumannomyces tritici R3-11...
EMD63926     204 SNGLIPDLIACRCERELDASAVEKIAHFCQVENEQVLVVRDMPSIYQVPMLLEQQKLIPMVRQFLAL 270 Bipolaris sorokiniana ND90Pr
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap