5VGC


Conserved Protein Domain Family
T3SS_NleG

?
pfam06416: T3SS_NleG 
Click on image for an interactive view with Cn3D
Effector protein NleG
Many bacterial pathogens deliver effector proteins into host cells via a type III secretion system. These effector proteins then alter the host cell's biology in ways that are advantageous to the pathogen. The NleG protein and its homologs form the largest family of effector proteins in the enterohemorrhagic Escherichia coli O157:H7, with 14 members identified in the Sakai strain alone.
Statistics
?
PSSM-Id: 368893
View PSSM: pfam06416
Aligned: 13 rows
Threshold Bit Score: 174.08
Threshold Setting Gi: 81764379
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5VGC_A                 106 NMDLLSNYQLEE--------------------LLDKIEVCAFNVEHAQLQVPESLRTCPVTLCEPEDGVFMRNSMNSNVC 165
nankaitd:CDCO157_2066    1 MLQLSSNIGWKKgae---------------naLKNKIHSHSFVVNPDEFSCDTQFLKCPITLCVPEKGVFVKNALNSNIC 65  Esche...
WP_001145628            93 MEQVRLTPFWLEggr---------------naVQTRINSHAFTVNPGDFPCCEQHLSCPITLCIPKTGVFVKNALHSKVC 157 Esche...
BAG66386                94 LEQRQAAPLVQEsvi---------------ktLLDRINSNAFPVSLQDFSCTEEHLNCPITLHIPETGVFVRNARNSEIC 158 Esche...
Q8XAN6                  94 MEQSRATPCTRQnvs---------------saIQNKINSHAFTVSHQDFSCHEQHLNCPITLCIPETGVFVRNAKNSEIC 158 Esche...
Q8X508                  97 FQSVMAEHRENKtgn---------------kiLMEKINSCVFGTDSNHFSCPESFLTCPITLDTPXTGVFMRNSRGAEIC 161 Esche...
Q8X507                 105 NMELLSNYQLEE--------------------LLDKIEVCAFNVEHAQLQVPESLRTCPVTLCEPEDGVFMRNSMNSNVC 164 Esche...
AAG56562                50 MGQVISEFMHSNdnr--------------ielLQRRLHSCSFLVNIEEMSYIDEALQCPITLAIPQRGVFLRNAEGSRVC 115 Esche...
nankaitd:CDCO157_2068   59 MVSGSGNTQSHGd-------------------IEGKISQCKFSVNTESLQCPSEAVRCPIILDKPEEGVFVKNSEGSLVC 119 Esche...
Q8X4X1                  81 MLSDSGEAQSQEs-------------------IQNKISQCKFSVCPERLQCPLEAIQCPITLEQPEKGIFVKNSDGSDVC 141 Esche...
nankaitd:CDCO157_1739A  66 MLSDSGEAQSQEs-------------------IQDKISQCKFPVSSGNFQCPPESIQCPITLERPEEGVFVKNSDSSAVC 126 Esche...
BAF96540                81 MLSDSGEAQSQEg-------------------IQSKISQYKFSVCPERLQCPPESAQCPITLEIPEEGVFIKNSGDSVVC 141 Esche...
Q8Z7T2                 106 MSTTSFSNNSQElaahsspgapaifdtsnkqqLVDKIDLCSFSPNVDELSCTEDNLTCPVMLVVPEKGVFVKTGPESNIC 185 Salmo...
5VGC_A                 166 MLYDKMALIHLVKTRAAHPLSRESIAVSMIVGRDNAAFDPDRGNFVLK 213
nankaitd:CDCO157_2066   66 TLYDKSAFMNLTREHLPHPLSREKIVKEMIIERNMCYFDTISQHFIIM 113 Escherichia coli Xuzhou21
WP_001145628           158 SLYDKDALSEAIRHNVFHPLSREAFSPEMIVGREECYFDLTDQRFCII 205 Escherichia coli
BAG66386               159 ALYDQEALTELILRNALHPLSRDPFAPEMIISKDKCHFNITKQCFYAL 206 Escherichia coli O111:H-
Q8XAN6                 159 SLYDHNALTELIRRNAPHPLSREPFVPEMIVSKDECHFNLIEQYFCIL 206 Escherichia coli O157:H7
Q8X508                 162 SLYDKDALVQLVETGGTHPLSREPITESMIMRKDECHFDAKREAFCCK 209 Escherichia coli O157:H7
Q8X507                 165 MLYDKMSLIYLVKTRAAHPLSRESIAVSMIVGRDNCAFDSDRGNFVLK 212 Escherichia coli O157:H7
AAG56562               116 SLYDEMALSRIINDGMHHPLSREPITLSMLVAREQCEFDCSIGHFTVR 163 Escherichia coli O157:H7 str. EDL933
nankaitd:CDCO157_2068  120 TLFDSVSFSHLVRDGGKHPLTREPITSSMIVSQEQCIYDQTKGNFVIK 167 Escherichia coli Xuzhou21
Q8X4X1                 142 TLFDAAAFSRLVGEGLPHPLTREPITASIIVKHEECIYDDTRGNFVIK 189 Escherichia coli O157:H7
nankaitd:CDCO157_1739A 127 CLFDFDAFSRLASEGSYHPLTREPITASMIISPDKCVYDPIKGNFIIK 174 Escherichia coli Xuzhou21
BAF96540               142 SLFDVTAFSRLVSEKSPHPLTREKLTASMVVSADKCFYDHGKGSFVIK 189 Escherichia coli O103:H2
Q8Z7T2                 186 QLFDETALIQLIIDGATHPVSRAPLSLDMIINKNECYFDTTKGNFIIP 233 Salmonella enterica subsp. enterica s...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap