4QAX,5KGM


Conserved Protein Domain Family
iPGM_N

?
pfam06415: iPGM_N 
Click on image for an interactive view with Cn3D
BPG-independent PGAM N-terminus (iPGM_N)
This family represents the N-terminal region of the 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (or phosphoglyceromutase or BPG-independent PGAM) protein (EC:5.4.2.1). The family is found in conjunction with pfam01676 (located in the C-terminal region of the protein).
Statistics
?
PSSM-Id: 399427
Aligned: 596 rows
Threshold Bit Score: 196.088
Threshold Setting Gi: 556924786
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4QAX_A                  90 INKSIEDGDFFENDVLNNAIAHVNSHDSALHIFGLLSDGGVHSHYKHLFALLELAKKQGVeKVYVHAFLDGRDVDQKSAL 169 Staph...
CCQ36377                79 VTDDIDAGVFADNEAIGEALSHADD-GGRVHFLGLVSDGGVHSYQAHLHALIELAAEQGV-EAVTHVFTDGRDTAPEGGV 156 Natro...
Q3IS17                  79 VTDDIDAGVFADNEALARAFDHADDHDGRVHFMGLVSDGGVHSYQSHLHALVDLAAERGV-EAVTHAFTDGRDTAPKSGV 157 Natro...
Q18GK9                  79 VEDAIDNGSFQTNAAINAAFNHAVATNGRVHFMGLLSDGGVHSEQEHLHALIELAGDRNI-DAITHVFTDGRDTNPHSSE 157 Haloq...
PRJNA71415:HALLA_06870  80 ISDAIEDGSFRKNDAINEAFDHARENDGRVHFLGLVSDGGVHSDQEHLHALIELAADRDV-EAVTHAITDGRDTSPTGGK 158 Halos...
WP_012941841            79 ISDSIADGSFRENDAINTAFDNARANDGKVHFVGLVSDGGVHSDHEHLHALIELAGDRDV-EAVTHAITDGRDTSPTGGR 157 Halot...
jgi:Halru_1272         109 ITDDIADGHLGENEAIDGAFEYARANDGRVHFLGLVSDGGVHSDQAHLHALLELAADRDV-EAVTHAITDGRDTAPTGGR 187 Halov...
WP_014053005            81 INDAVEDGSLAELPAITNALDHAAENEGRIHFFGLVSDGGVHSDQTHLHALIELAAERDV-EAVTHAFTDGRDTPPESGA 159 halop...
WP_008414966            82 INDAVSDGAFRTNEALAGVFDHVEGSGGRVHFLGLVSAGGVHSDQKHLHALIEWAADRGV-EAVTHAFTDGRDTDPKSGA 160 Halal...
BFU:L593_11605          79 INDAIAAGELDDNNALLGAIDGARDRGGRVHFMGLVSDGGVHSSQQHLHALIDLAAERGA-TAVTHAFTDGRDTDPDSGA 157 Salin...
4QAX_A                 170 KYIEETEAKFNELGIGQFASVSGRYYAMDRDKRWEREEKAYNAIRNFDAptYAt-AKEGVEASYNEGLTDEFVVPFIVEn 248 Staph...
CCQ36377               157 GFLADLEATVEANGTGHVGTVCGRYYAMDRDGNWARTKRAYDAIVEGEAphAAasAVEAVEASYDRGETDEYVEPTLIeg 236 Natro...
Q3IS17                 158 GFIEDLAATVEEAGTGDVATVCGRYYAMDRDENWERTKRAYDAIVHREAphEAdsAVAAVAASYDRGDTDEYVEPTLVSg 237 Natro...
Q18GK9                 158 QYLTTLEEVIHTHGTGDIATVSGRYYAMDRDKNWTRTRMSYDAIVNRTAehTTstALEAVSESYDRGDTDEFIEPTLIdn 237 Haloq...
PRJNA71415:HALLA_06870 159 GYLTALEEAIDTHGTGDVATVSGRYYAMDRDQNWERTKRAYDAIVSREAeyEAdsAVDAVESAYDRGKTDEFVEPTLVsg 238 Halos...
WP_012941841           158 DYLSTLEDVVAEHGTGDVATVTGRYYAMDRDQNWERTKRAYDAMVHREAdhEAdsAVEAVEQSYDRDVTDEFVEPTVIad 237 Halot...
jgi:Halru_1272         188 EYLQALESVVDSAGTGDIATVSGRYYAMDRDQNWERTKRAYDAIVEREAayEApsALAAVEESYERGDTDEFVEPTVVad 267 Halov...
WP_014053005           160 GYLELLETVVERAGTGDISTVTGRYYAMDRDHNWERTHKTYEAIVNREVryETdnAVAAVEESYARGESDEFVEPTLVad 239 halop...
WP_008414966           161 GYLRELEEVIEKAGTGEVATVSGRYYAMDRDTNWERTRKAYDAMVNREAeyTApsGTAAVEAAYDRGETDEFVEPTLVes 240 Halal...
BFU:L593_11605         158 GYVEELEAHVAEAGTGDVATLEGRYWAMDRDTNWERTKKAYDAIVAREAeyEAesGLDAVSQAYDRDETDEFIEPTLIeg 237 Salin...
4QAX_A                 249 qnDGVNDGDAV-----------------IFYNFRPDRAAQLSEIFA--NR-A-FEGFkveQV-KDLFYATFTKYND 302 Staphyloc...
CCQ36377               237 -aPPLSDGDAA-----------------VFFNFRADRARQLTRMLAdiDP-EwAVET----DpPEVELVTMTEYDE 289 Natronomo...
Q3IS17                 238 tdAPLSADDAV-----------------VFFNFRADRARQLVRMLAdiDP-DwAFET----DpPAAALVTMTEYDE 291 Natronomo...
Q18GK9                 238 -tPAVEDGDAV-----------------FVFNFRPDRVRQLVRMLAdiDP-AwSFET----DpPTTELATMAQYDE 290 Haloquadr...
PRJNA71415:HALLA_06870 239 -aPALEDGDSV-----------------VWFNFRSDRARQLTRMLAdiRP-VwEFET----SpPEIELVTMTEYDE 291 Halostagn...
WP_012941841           238 -gPALEDGDSV-----------------VWFNFRSDRARQLTRMLAdiRPeDwADQFe--TSpPDAEVVMLTQYDK 293 Haloterri...
jgi:Halru_1272         268 -qPAIDDGDAV-----------------VWFNFRADRARQLTRLLSdiRPdDwADAFe--LSpPETQVVMLTEYDR 323 Halovivax...
WP_014053005           240 -aPTLQNGDSA-----------------FAFNFRADRTRQLCRLLAglHAeDwPFSL----EqPEIHLATMTRYEE 293 halophili...
WP_008414966           241 -gPTTRDGDSTeqrsagdrlairdddaaIFFNFRGDRGRQLTRMLQdiRP-EwDVDT----PaPDVHLVAMTQYDK 310 Halalkali...
BFU:L593_11605         238 -qPALEDGDAV-----------------VFFNFRPDRARQLVRMLTntEP-DwEYDL----DpPEIDLATLTEYDE 290 Salinarch...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap