1N93


Conserved Protein Domain Family
BDV_P40

?
pfam06407: BDV_P40 
Borna disease virus P40 protein
This family consists of several Borna disease virus P40 proteins. Borna disease (BD) is a persistent viral infection of the central nervous system caused by the single-negative-strand, nonsegmented RNA Borna disease virus (BDV). P40 is known to be a nucleoprotein.
Statistics
?
PSSM-Id: 399421
Aligned: 4 rows
Threshold Bit Score: 411.385
Threshold Setting Gi: 861589779
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1N93_X    26 EPPASLP------KLPGKFLQYTVGGSDPHPGIGHEKDIRQNAVALLDQSRRDMFH-TVTPSLVFLCLLIPGLHAAFVHG 98 
P0C797    21 EPPASLP------KLPGKFLQYTVGGSDPHPGIGHEKDIRQNAVALLDQSRRDMFH-TVTPSLVFLCLLIPGLHAAFVHG 93  Borna disease virus-V
KMQ82686  42 EEGEAITta--ifWMLGK-----------RPNIIPTRQINEAT---LDEQQRTALRkSIESHLSDQLLVFLGMAGVMTLV 105 Lasius niger
P0CF75    18 KDGSSFHyfqgrfELSGKSRQYPADALEPQPGIGDVKVIEKATKSMLDPAQRSHFY-LVTPSLVFLCFIFDGLHKALLSV 96  human
1N93_X    99 GVPRESYLSTPVTRGEQTVVKTAKFygeKTTQRDLTELEISSIFSHCCS-LlIGVVIGSSSKIKAGAEQIKKRFKTMMAA 177
P0C797    94 GVPRESYLSTPVTRGEQTVVKTAKFygeKTTQRDLTELEISSIFSHCCSlL-IGVVIGSSSKIKAGAEQIKKRFKTMMAA 172 Borna disease virus-V
KMQ82686 106 KEVRSTGPTANTEYLTKRWQ------------------------------A-ICATMGIRDEFAAGGKVSREMFHGMIKL 154 Lasius niger
P0CF75    97 GVSKRSNIVIGNENKETGTLYASKF---EDVLPTFTALEMSSILRHCCD-L-IGIAAGSSDPICTNSLQVQRQFKAMMIS 171 human
1N93_X   178 LNRPSHGETATLLQMFNPHEAIDWINGQPWVGSFVLSLLTTDFESP----GKEFMDQIKLV------ASYAQMTTYTTIK 247
P0C797   173 LNRPSHGETATLLQMFNPHEAIDWINGQPWVGSFVLSLLTTDFESP----GKEFMDQIKLV------ASYAQMTTYTTIK 242 Borna disease virus-V
KMQ82686 155 I-----------------ESWQTWVKARANVRREILTLSIEDIPDQapemVKKVLEQIKMVlhgyglKSTEVMCGFTTSD 217 Lasius niger
P0CF75   172 IGRPLHSESADLLISYNAGPAIDWINSRPWVGGLMFTFLFGEFESP----ACELLDQVKVV------ASKAQMMTYYTVR 241 human
1N93_X   248 EYLAECMDATLTIPVVAYEIRDFLEVSAKLKEDHADLFPFLGAIRHPDAIKLAPRSFPNLASAAFYWSKKENPTMAGYRA 327
P0C797   243 EYLAECMDATLTIPVVAYEIRDFLEVSAKLKEDHADLFPFLGAIRHPDAIKLAPRSFPNLASAAFYWSKKENPTMAGYRA 322 Borna disease virus-V
KMQ82686 218 -------SEALLIPQVNQQTIDLKKVVAELKAQHGPLYPYLRVFPLPGADRLHHRNYPDLYYAAVSTAVHNKDLGVEGRY 290 Lasius niger
P0CF75   242 MFLDQCVDGSTALPAVVLEIPVFEQKKPLAKKVLGDFFEFGGVLRHPVIGVLSPQMFPNLATAANYWAKRRNSTFSGFEA 321 human
1N93_X   328 STIQPGASVKETQLARYRRREISRGEDgaeLSGEISAIMKMIGVTGLN 375
P0C797   323 STIQPGASVKETQLARYRRREISRGEDgaeLSGEISAIMKMIGVTGLN 370 Borna disease virus-V
KMQ82686 291 QMTDDQTTTSKAVIDRMADRLLh------aRVGVDQTTIQNLAELGIT 332 Lasius niger
P0CF75   322 LDIIPGSTITFPVLQMASAQKISRGSD---MDPYTLNILRGYGISGFE 366 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap