4OR8,4U2X


Conserved Protein Domain Family
Filo_VP24

?
pfam06389: Filo_VP24 
Click on image for an interactive view with Cn3D
Filovirus membrane-associated protein VP24
This family consists of several membrane-associated protein VP24 sequences from a variety of Ebola and Marburg viruses. The VP24 protein of Ebola virus is believed to be a secondary matrix protein and minor component of virions. VP24 possesses structural features commonly associated with viral matrix proteins and that VP24 may have a role in virus assembly and budding.
Statistics
?
PSSM-Id: 399409
Aligned: 2 rows
Threshold Bit Score: 379.769
Threshold Setting Gi: 672886780
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4OR8_A  28 VTENSINL-DLnstARWIKEPSVGGWTVKWGNFVFHIPNTGMTLLHHLKSNFVVPEWQQTRNLFSHLFKNPKSTIIEPFL 106 Marburg virus - Musok...
4U2X_A   1 DLEKGVVLsDL---CNFLVSQTIQGWKVYWAGIEFDVTHKGMALLHRLKTNDFAPAWSMTRNLFPHLFQNPNSTIESPLW 77  Ebola virus - Mayinga...
4OR8_A 107 ALRILLGVALKDQELQQSLIPGFRSIVHMLSEWLLLEVTSAIHISPNLLGIYLTSDMFKILMAGVKNFFNKMFTLHVVND 186 Marburg virus - Musok...
4U2X_A  78 ALRVILAAGIQDQLIDQSLIEPLAGALGLISDWLLTTNTNHFNMRTQRVKEQLSLKMLSLIRSNILKFINKLDALHVVNY 157 Ebola virus - Mayinga...
4OR8_A 187 HGKPSSIEIKLTGQQIIITRVNMGFLVEVRRID------IEPccgetvlsESVVFGLVAEAVLREHS 247 Marburg virus - Musoke, Kenya, 1980
4U2X_A 158 NGLLSSIEIGTQNHTIIITRTNMGFLVELQEPDksamnrMKP--------GPAKFSLLHESTLKAFT 216 Ebola virus - Mayinga, Zaire, 1976
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap