Conserved Protein Domain Family
RhaT

?
pfam06379: RhaT 
L-rhamnose-proton symport protein (RhaT)
This family consists of several bacterial L-rhamnose-proton symport protein (RhaT) sequences.
Statistics
?
PSSM-Id: 115061
View PSSM: pfam06379
Aligned: 2 rows
Threshold Bit Score: 589.638
Threshold Setting Gi: 62511083
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P27135   1 MSNAITMGIFWHLIGAASAACFYAPFKQVKQWSWETMWSVGGIVSWLILPWTISALLLPDFWAYYGQFNLSTLLPVFLFG 80  Salmonella enterica s...
Q8ZIZ8   1 MNNAIILGIIWHLVGAASAACFYAPFKQVKKWSWETMWSIGGLVSWLILPWTVSYLLLPDFWQYYGSFSIATLLPVFLFG 80  Yersinia pestis
P27135  81 AMWGIGNINYGLTMRYLGMSMGIGIAIGITLIVGTLMTPIINGNFDVLIHTEGGRMTLLGVFVALIGVGIVTRAGQLKER 160 Salmonella enterica s...
Q8ZIZ8  81 AMWGIGNINYGLTMRYLGMSMGIGIAIGITLIIGTLMTPILQGRFDVLLGTPGGRMTLLGVFVALIGVAIVSYAGLLKER 160 Yersinia pestis
P27135 161 KMGIKAEEFNLKKGLLLAVMCGIFSAGMSFAMNAAKPMHEAAAALGVDPLYVALPSYVVIMGGGALVNLGFCFIRLAKVQ 240 Salmonella enterica s...
Q8ZIZ8 161 AMGIQAEEFNLKKGLILAVMCGIFSAGMSFAMDAAKPMHEAASALGINSLYVALPSYVIIMGGGAIINLSYCFIRLATLK 240 Yersinia pestis
P27135 241 NLSIKADFSLARPLIISNILLSALGGLMWYLQFFFYAWGHARIPAQYDYMSWMLHMSFYVLCGGLVGLVLKEWKNAGRRP 320 Salmonella enterica s...
Q8ZIZ8 241 NLSVKADFSVAKPLLITNILFSALAGLMWYLQFFFYAWGHAKIPQQYDYMSWMLHMSFYVLCGGIVGLLLKEWKCSTKKP 320 Yersinia pestis
P27135 321 VAVLSLGCVVIIIAANIVGLGMAS 344 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
Q8ZIZ8 321 VAVLCIGCLVIILAANIVGLGMAA 344 Yersinia pestis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap