1KD6,2KS4


Conserved Protein Domain Family
Anemone_cytotox

?
pfam06369: Anemone_cytotox 
Click on image for an interactive view with Cn3D
Sea anemone cytotoxic protein
Sea anemones are a rich source of cytotoxic proteins. Cytolysins comprise a group of more than 30 highly basic proteins with molecular masses of about 20 kDa. Cytolysins isolated from the sea anemone, Heteractis magnifica, include magnificalysin I (HMg I), magnificalysin II (HMg II) and Heteractis magnifica toxin (HMgtxn). These are highly homologous at their N-terminals. HMg I and II have molecular masses of approximately 19 kDa, and pI values of 9.4 and 10.0, respectively. Cytolysins isolated from other sea anemones Actinia tenebrosa (Tenebrosin-C, TN-C), Actinia equina (Equinatoxin, EqT) and Stichodactyla helianthus (ShC) exhibit pore-forming, haemolytic, cytotoxic, and heart stimulatory activities.
Statistics
?
PSSM-Id: 399397
Aligned: 3 rows
Threshold Bit Score: 305.667
Threshold Setting Gi: 300680842
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1KD6_A   3 DVAGAVIDGASLSFDILKTVLEALGNVKRKIAVGVDNESGKTWTALNTYFRSGTSDIVLPHKVPHGKALLYNGQKDRGPV 82  Actinia equina
D2YZQ3  50 AVAGAVIAGGELALKILTKILDEIGKIDRKIAIGVDNESGLKWTALNTYYKSGASDVTLPYEVENSKALLYTARKSKGPV 129 Actineria villosa
2KS4_A   2 ELAGTIIDGASLTFEVLDKVLGELGKVSRKIAVGIDNESGGTWTALNAYFRSGTTDVILPEVVPNTKALLYSGRKSSGPV 81  Stichodactyla helianthus
1KD6_A  83 ATGAVGVLAYLMSDGNTLAVLFSVPYDYNWYSNWWNVRIYKGKRRADQRMYEELYYNLSPFRgDNGWHTRNLGY-GLKSR 161 Actinia equina
D2YZQ3 130 ARGAVGVLAYKMSSGNTLAVMFSVPFDYNLYTNWWNVKIYDGEKKADEKMYNELYNNNNPIK-PSIWEKRDLGQdGLKLR 208 Actineria villosa
2KS4_A  82 ATGAVAAFAYYMSNGNTLGVMFSVPFDYNWYSNWWDVKIYPGKRRADQGMYEDMYYG-NPYRgDNGWYQKNLGY-GLRMK 159 Stichodactyla helianthus
1KD6_A 162 GFMNSSGHAILEIHVTK 178 Actinia equina
D2YZQ3 209 GFMTSNGDAKLVIHIEK 225 Actineria villosa
2KS4_A 160 GIMTSAGEAKMQIKISR 176 Stichodactyla helianthus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap