1CB7


Conserved Protein Domain Family
Met_asp_mut_E

?
pfam06368: Met_asp_mut_E 
Methylaspartate mutase E chain (MutE)
This family consists of several methylaspartate mutase E chain proteins (EC:5.4.99.1). Glutamate mutase catalyzes the first step in the fermentation of glutamate by Clostridium tetanomorphum. This is an unusual isomerisation in which L-glutamate is converted to threo-beta-methyl L-aspartate.
Statistics
?
PSSM-Id: 399396
Aligned: 32 rows
Threshold Bit Score: 508.325
Threshold Setting Gi: 504439661
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1CB7_B          42 IPAEKNFAEKLVLAKKKGITMAQPRAGVALLDEHIELLRYLQDEGGADFLPSTIDAYTRQNRYDECENGIKESEKAGRSL 121
jgi:Natgr_2183  41 LPASKQFATVLESADR---VLTQPRAGVPCLDDQIDLLETLVTDGDVDLLPVTIDSYTRDNQYEKAREGLERSRETDADE 117 Natronobacter...
Q9HN20          41 LPPHKRFAAVLENAEA---VLCQPRAGVPRLDEHVELLQHLDEEGGADLLPTTIDSYTRDNAYEKAAEGLARSRETDSSE 117 Halobacterium...
jgi:Halru_1551  41 LPPSKEFATVLESATE---PLLQPRAGVARLDEQIELLTYLEETGEADLLPTTIDSYTRDNEYGKARTGLEKTRESDADA 117 Halovivax rub...
WP_015763928    41 lPPGKQFAPVLESADR---PLLQPRAGVPCLEAQIDLLRYLEQQGGADLLPTTIDSYTRDNEYEKAEEGLAASRNSDEDA 117 Halomicrobium...
WP_005576812    41 LPAHKRFADVLESADK---PLLQPRAGVPRIDDQIELLEYLHREGQADLLPTTIDSYTRDNEYEKAQEGLEKARETGENT 117 Natronobacter...
WP_020445778    41 LPDSKRFADVLESAET---PLLQPRAGVPRLDDQIELLRHLQNEGGADLLPTTIDSYTRDNEYGKAGDGLEDARETAEDT 117 Salinarchaeum...
WP_015051095    42 lPKEKVAYYKLLKGQAEGRIYLQPRAGVALIDEHIALLRSLEKEGEADFLPTTVDSYTRQNRYSEAARGIKESKAADRSL 121 Thermacetogen...
BAF60601        43 LPESKIFYKQLQKLDTEKRMANFPRAGTPILEDEIELVRTLNSLG-VICTPLTTDSYTRNLQFEKAQQGLEESIRTGKPK 121 Pelotomaculum...
Q8RHY5          42 LPDHKNFQKKIEQSVQDNKIMTQAHSKETLLEDLIKNLNTFYRVGQADFLSIIIDSHTRENHYDNAKVILEDSIKSNKSL 121 Fusobacterium...
1CB7_B         122 LNGFPGVNFGVKGCRKVLEAVNLPLQARHGTPDSRLLAEIIHAGGWTSNEGGGISYNVPYAKNVTIEKSLLDWQYCDRLV 201
jgi:Natgr_2183 118 LNGFPAVTHGVEGCRTLVEAADAPVQIRHGTPDARLLAAVTFASGVQSFEGGPITYNLPYTSKYSLEETIEYWQYVDRLA 197 Natronobacter...
Q9HN20         118 LNGFPAVNHGVEGCREVVRRVDAPVQVRHGTPDARLLAAVTLAGGFQSFEGGPITYNLPYTSAYDLETTIEYWQYVDRLC 197 Halobacterium...
jgi:Halru_1551 118 LNGFPAVNHGVDGCRTLVESVDGPIEVRHGTPDARLLAAVTLAGGFQSFEGGPISYNIPYTKRGDLATTIEHWQYVDRLA 197 Halovivax rub...
WP_015763928   118 LNGFPAVNHGVEDCRRLVRALDTPIEVRHGTPDARLLAMVTLAGGFQSFEGGPISYNIPYTKGHSLEETITHWQFVDRLC 197 Halomicrobium...
WP_005576812   118 LNGFPAVNHGVDGCRELIESIEAPIEVRHGTPDARLLAAITFAGGFQSFEGGPISYNIPYTKRHGLEETIEKWQFVDRLA 197 Natronobacter...
WP_020445778   118 LNGFPAVNHGVEGCRDLICALDAPIEVRHGTPDARLLAAVTYAGGFQSFEGGPISYNIPYTKERDLATTIEQWQYVDRLA 197 Salinarchaeum...
WP_015051095   122 LNGLPAVNYGVKNCRRIIEATGVPVQVRHGTPDARLLAEITLAAGFTDFEGGGISYNIPYAKDVPLERSLLHWQYVDRLC 201 Thermacetogen...
BAF60601       122 LNGYPIINHGLKNNRKLVESVDGCLDPRCSRKANSQVAEMAFASGMNAMPCSFFAWFGGYDKKATIEECIETAQYMGRLM 201 Pelotomaculum...
Q8RHY5         122 LNGFPLINYGTKLARKIINDVEVPLQIKHGSPDARLLVEVALLSGFSAFDGGGISHNIPFSKSISLKDSLENWKYVDRLV 201 Fusobacterium...
1CB7_B         202 GFYEEQGVHINREPFGPLTGTLVPPSMSNAVGITEALLAAEQGVKNITVGYGECGNMIQDIAALRCLEEQTNEYLKAYGY 281
jgi:Natgr_2183 198 GAYTERGIRINREPFGPLTGTLVPPSIAIAVCIVEGLLSATQGVRSITLGYGQVGNLVQDVAAIEAMKTLGVEYLPd--- 274 Natronobacter...
Q9HN20         198 GAYTERGVTINREPFGPLTGTLVPPSIAIAIVTIEGLLAATQGVRSVTLGYGQVGNLVQDVAAVRAMAAIGAEYLPd--- 274 Halobacterium...
jgi:Halru_1551 198 GVYTERGVRINREPFGPLTGTLVPPSIAIAIMIVEGLLAATQGVRSLTLGYGQVGNVVQDVAALRALRALGEEYLPn--- 274 Halovivax rub...
WP_015763928   198 GAYAERGVVVNREPFGPLTGTLVPPAIAIAVMLVEGLLAATQGVRSLTLGYGQVGNVVQDVAALRALGALGEEYLPd--- 274 Halomicrobium...
WP_005576812   198 GAYTERGVRINREPFGPLTGTLVPPSIAIAIMIVEGQLAATQGVRSITLGYGQVGNVVQDVAALNALQKLGDEYLPd--- 274 Natronobacter...
WP_020445778   198 GAYTERGVRINREPFGPLTGTLVPPCIAIAVMVVEGMLAATQGVRSITLGYGQVGNFVQDVAALHALRSLGEEYLPd--- 274 Salinarchaeum...
WP_015051095   202 GFYAEHGIIINREMFGPLTGTLVPPFISHVVGIIEALLAAGQGVKSIAIGYGQGGNLIQDAAALRTLARLGRSYLDRFGY 281 Thermacetogen...
BAF60601       202 GYYAENGVIINADCHGWLPNGVIPMSVNIATQIIEALIVIGQGAKCVMPQVNLQGCLAQDLADIRTVPKLYKKYIEKLGY 281 Pelotomaculum...
Q8RHY5         202 GIYEENGIKINREIFSPLTATLVPPAISNSIQILETLLAVEQGVKNISIGVAQYGNITQDIASLLALKEHIQFYLDTFSF 281 Fusobacterium...
1CB7_B         282 nDVFVTTVFHQWMG--GFPQDESKAFGVIVTATTIAALAGATKVIVKTPHEAIGIPTKEANAAGIKATKMALNMLEGQRM 359
jgi:Natgr_2183 275 -EVTVTTVFHQWMG--GFPADEPRANGVIALGTAAAGIAEPDKIITKSPQEALGVPTADANAAGLRTTDQVLRMLSAQSV 351 Natronobacter...
Q9HN20         275 -SVTVTTVLHQWMG--GFPRDEARAHGVIGLAGATAALVEPTKVITKSPQEAVGVPTAESNAAGLRTTDQVLRMLDEQSI 351 Halobacterium...
jgi:Halru_1551 275 -EVCVTTVFHEWMG--GFPPDEARANGVIGLGALTAAIARPDKVITKSPQEFQGVPTKEANAAGLRTTRQLLDMAMEQRL 351 Halovivax rub...
WP_015763928   275 -DVTVTTVFHEWMG--GFPPDEARASGVIGLGGVTAAVARPDKVITKSPQEFQGVPTKEANAAGLRTTRQLIDMTIEQDI 351 Halomicrobium...
WP_005576812   275 -EVVVTTVFHEWMG--GFPPDEARANGVISLGGMTAAIAQPDKVITKSPQEFQGVPTKEANASGLRTTRQVIDMAIEQNI 351 Natronobacter...
WP_020445778   275 -PVRVTIVFHEWMG--GFPPDEARANAVISLGAATAAIAEPDKVITKSPQEFAGVPTMEANAAGLRTTRQLIDMLLEQNV 351 Salinarchaeum...
WP_015051095   282 sDVLLTTVFHQWMG--GFPQEEPRALGVIAWGAATAALAGANKVIVKTPHEAMGVPSLEANLAGLLCTRQVLRMLAEQRV 359 Thermacetogen...
BAF60601       282 kDIIISGVVGSQvplypYPQDVGSAFGYSTYTAMVAALGKVPIAFIKTIDEALGVPSTESHVQTYKACNWIFNVIRTQDF 361 Pelotomaculum...
Q8RHY5         282 kDINISTVFNQWIG--GFPEEELKAYSLISYSTTIALFSKTNRIFVKNIDEYAKNSLGNTMINSLLLTKTILDIGNNQKI 359 Fusobacterium...
1CB7_B         360 P-MSKELETEMAVIKAETKCILDKMFELGKGDLAIGTVKAFETGVMDIPFGPSKYNAGKMMPVRDNLGCVRYLEFGNVPF 438
jgi:Natgr_2183 352 --DLEAVDRERELIERSVRSLLDAVYEVGDGDVARGVVRAFDEGLLDVPFPPSEAAAGDILPARDDEGRVRLLKFGDLAL 429 Natronobacter...
Q9HN20         352 --TLDGVDREQALIERSVRSLLDAVYEAGDGDIARGTVRAFDAGTLDIPFPPSDAAAGDVLPARDDDGRVRLLKFGAVAL 429 Halobacterium...
jgi:Halru_1551 352 --DIDGVESEQDLIERETRSLLEAVFEHGEGDVARGAVRAFETGALDVPFAPSESAKGACLPARDDDGRVRLFDFGDLAF 429 Halovivax rub...
WP_015763928   352 --DLAGIDEEQRLIEQTTRALMDAIDRHGDGDVAQGVIRAFESGAMDVPFAPSDAAAGAVLPARDDDGRVRMFEFGDLAV 429 Halomicrobium...
WP_005576812   352 --DIDGIAEEQDLIERETRCLMDTIYDHGDGDVVRGTIEAFDSGVLDVPFAPSDSAKGAVLPARDDDGRVRIFEWADLEM 429 Natronobacter...
WP_020445778   352 --QLEGVDRELNLIQKASRELIEAAIDAGDGDVAQGTIQAFETGALDVPFAPSESAQGAVLPARDDDGRVRILEFGDLAL 429 Salinarchaeum...
WP_015051095   360 P-ETPELAEEESVIEREVREVFDRVLELGEGDLAVGTVRAFEAGVLDIPFAPSRAARGGIMPVRDASGAIRLLDTGNIPL 438 Thermacetogen...
BAF60601       362 EiDNEAIRQEEKITEAEVTAILDKVLDMGDGDVAVGAVKAVEAGVLDSPFSISIYAKDKVLGIRDLNGACRYLEFGNLPI 441 Pelotomaculum...
Q8RHY5         360 N-NYEEIIFEKEQIKKETAQIIAKIFSRCDGDLRKAIIEAFEYGVLDVPFAPSKYNLGKMMPARDSEGMIRYLDIGNLPF 438 Fusobacterium...
1CB7_B         439 TEEIKNYNRERLQERAKFEGRDVSFQMVIDDIFAVGKGRLIGRP 482
jgi:Natgr_2183 430 DEDIKRRHRADLETRARTEDRRPSFRMVADDVSAVSDGRLIGRP 473 Natronobacterium gregoryi SP2
Q9HN20         430 DDETKRIHRARLDRRADTEGRELSFRMVADDVSAVSDGRLIGRP 473 Halobacterium salinarum NRC-1
jgi:Halru_1551 430 DDEIKEIHAARLERRAETEDRSTSFHMVADDVDAISNGRLIGRP 473 Halovivax ruber XH-70
WP_015763928   430 PDEIREIHENKLGKRAEREGRAQSFQMVADDVDAISDGKLIGRr 473 Halomicrobium mukohataei
WP_005576812   430 DDDIKEIHRARLSRRADTEGRDQSFRMVADDVDAISDGKLIGRP 473 Natronobacterium gregoryi
WP_020445778   430 SADVQEIHENRLEARASTEGRDRSFKMVADDVDAISDGRLIGRP 473 Salinarchaeum sp. Harcht-Bsk1
WP_015051095   439 SAEIKDFHRKKIEERGRQEKREPGLRMVIDDIYAISKGRLVGKP 482 Thermacetogenium phaeum
BAF60601       442 PEDIKDFHRQKVAERAKAEGREMNYKVSLEDFWAISKGQLIGKs 485 Pelotomaculum thermopropionicum SI
Q8RHY5         439 CPLIEEFHNKKIKERSMKENREINFQMTIDDIFAMSQGKLINKK 482 Fusobacterium nucleatum subsp. nucleatum ATCC 25586
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap