Conserved Protein Domain Family
DUF1067

?
pfam06362: DUF1067 
Protein of unknown function (DUF1067)
This family consists of several hypothetical Mycobacterium leprae specific proteins. The function of this family is unknown.
Statistics
?
PSSM-Id: 115044
View PSSM: pfam06362
Aligned: 2 rows
Threshold Bit Score: 134.285
Threshold Setting Gi: 75420434
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9ZBE1   1 MTTPTPQGHDMHTKTPLPRGANNYPHTHACIDIAFSTAQVPSPWHHQHVDQAASTTDMLTCAALIVSTAAKHTKPHRKQA 80  Mycobacterium leprae
Q9RIA6   1 MTTPTPQGHDMHTKTPLPRGANNYPHTHACIDIAFSTAQVPSPWHHQHVDQAASTTDMLTCAALIVSTAAKHTKPHRKQA 80  Mycobacterium leprae
Q9ZBE1  81 VSHPPTKTPQHSNKRFS 97  Mycobacterium leprae
Q9RIA6  81 VSHPSTKTPQHSKTRQQ 97  Mycobacterium leprae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap