Conserved Protein Domain Family
DUF1057

?
pfam06342: DUF1057 
Alpha/beta hydrolase of unknown function (DUF1057)
This family consists of several Caenorhabditis elegans specific proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.
Statistics
?
PSSM-Id: 115027
View PSSM: pfam06342
Aligned: 6 rows
Threshold Bit Score: 443.813
Threshold Setting Gi: 21264144
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8WT51  37 LIKTVNVTYKTGVNLEETTTVESKYVDVTPSSNTKGTVVTLSGSPGTHNDFKYMKSFFEQKKIRLICTNYPGSEFVTGGL 116 Caenorhabditis elegans
Q9N4E0  15 EPKLYSKLVQFQTKRGRLVDLNAVYEDTSASGSPLGTVIGFHGTPGSHKDFKYVRQRLEHMNIRFIGINYPGFKQTPAYP 94  Caenorhabditis elegans
Q9N4E2   3 EPNLCRKLVKFETESGKKVELDAVYEDSLTSGSPFGTVVAFHGSPGSHNDFKYIRSKLDDLKIRFIGVNYPGFTFTNEYP 82  Caenorhabditis elegans
Q9N4E1  11 EPKLLKKLVKFQAENEQFVELEAVYEDSITSGSPFGTVVAFHGSPGSHNDFKYIRSKLDDLNIRFIGVNYPGFSNTPEYE 90  Caenorhabditis elegans
O16919  29 EPNMHRKLVKFQAENGKQVEVQAVYEDSLSTGSSVGTVVAFHGSPGSHNDFKYIRQQFDEAGIRFIGLNYPGFKQTDGYP 108 Caenorhabditis elegans
O62084  20 LCKTVFVTYKAGPGLKKIVTVQAQYVDICNKPNVRGTVVSLPGSPGSHNDIKYMRDSFEKHNIRLICVNWPGSEFVTGGM 99  Caenorhabditis elegans
Q8WT51 117 HNSYTNQDRNSYMKSLMETLELKnvNRLIIMGHSRGGENALQLTSMLsndenwPLVGAVMINSPGFAPHKGISK--RMGT 194 Caenorhabditis elegans
Q9N4E0  95 GQHFGNWERNSYSEALLNELDVQ--GKVIIMGHSRGCESALITATNR------KPHGLVMVNPTGLRIHKGSRPkgKLES 166 Caenorhabditis elegans
Q9N4E2  83 DQKHINIERQNYSNALLDELGID--GKMAYIGHSRGCENALQTAVAR------DAHGIVLINPTGLRIHKGINPisRMTT 154 Caenorhabditis elegans
Q9N4E1  91 GQQHANPERQNFSNALLDELKID--GKIIYMGHSRGCENALQTAVGR------EAHGLVLINPTGFRHHQGIRPfyRLEY 162 Caenorhabditis elegans
O16919 109 GQGHCNKERQNYTDAFLKSADLS--GKVIFLAHSRGCENALMTATTF------PAHGLVMMNPLGLRKHKSIRPlsRLER 180 Caenorhabditis elegans
O62084 100 NDTYTNAERNSYAKALMEKLELKkvEKLILLGHSRGGESALQLACTLsddrswPLIGAVMLNSPGFVVHRGISI--RMGT 177 Caenorhabditis elegans
Q8WT51 195 INFIISLIKRhnKTINSIlhpilhYFYNNLIGLRVSHGKVAAAAILPMQTFAFDEQKLSIDDLRAKPgIRAFYGYGSKDF 274 Caenorhabditis elegans
Q9N4E0 167 LVYFHKKLPK--TVGDTIm-----YNLMKSVGFKIQDGEEAVAVIRAIMNCDLEKQLEYILKLNEQP-TKTMITFGGSDH 238 Caenorhabditis elegans
Q9N4E2 155 VDSIYKMLPL--FLGNAMm-----LGVYKAFGFKITTGEEAVNSMRSMINVSLGGQLEFIEKTNDMN-VKKLIVFAGKDH 226 Caenorhabditis elegans
Q9N4E1 163 LDWMYGLLPS--FLGNSMi-----LGIYKAIGFKVKSGEEAMCAMRSVMRMSLEDQIEYIEKLNQKH-TKKLIVFGGNDH 234 Caenorhabditis elegans
O16919 181 IEWVYDMLPK--FLADAMi-----YRMYLSFGLKVQDGEEAISALRSVIRCGLETTLPNIHKLREQD-TKTFIIFAGKDL 252 Caenorhabditis elegans
O62084 178 INTVSFLVKLrwKIVDCIlfpvldWFYNDFVGLRVSDGKVCAAAMLPMQTFAFEEQRASIDEMKKKPwIRMFYAYGSKDF 257 Caenorhabditis elegans
Q8WT51 275 LIDEHQSEEVAMYFSEEDHYVIsNKQDAEKAIKEARKSFTtGKQFVTANFKEEGHFLQKTYPEFIVEVVDSIFD 348 Caenorhabditis elegans
Q9N4E0 239 LIEKEIVFEALKKYQGLAHFNF-KANITESEKQKIMESFK-NQKGTSVFIAKDNHFQNKKRADLLADAARSMLL 310 Caenorhabditis elegans
Q9N4E2 227 LVEEEIVFETLEKHEGLQHFNI-DKEISEAERLKILDSFTgTQRGASVFVAQDNHFQNKSRAGLVAEACKAMFE 299 Caenorhabditis elegans
Q9N4E1 235 LVEEEIVLEKLEKHDGLEHFRF-EDGISEEEKSKIMECFTgNQLGASVFVAKDTHFQNKSQAELVAESCKKMLD 307 Caenorhabditis elegans
O16919 253 ICEDEIVFEALKEYRDLVHFDY-DSEIPTDDYGKILKTFDs-EKGASVFVAKDTHFQNKKRADLVAEVVKKIFD 324 Caenorhabditis elegans
O62084 258 LVDESDSEELAMHFGG-DHYIIhSKKESEETIPKIWNSYErGQSYVTANFTEEGHYLHKTYPEFLIQIFGGIFD 330 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap