2A8E


Conserved Protein Domain Family
DUF1054

?
pfam06335: DUF1054 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1054)
This family consists of several hypothetical bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 399382
Aligned: 38 rows
Threshold Bit Score: 246.744
Threshold Setting Gi: 122269443
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2A8E_A         6 FTEEDFNTFTIEGLDARXEVLKETVRPKLTALGEHFAPTLSALTGDEXFPHVAKHARRSVNPPADSWVAFANSKRGYKKL 85  Bacillus subtilis
Q88UW9         2 FTNQDFEIFNDQTLAGRMHLIKTVIDPKFEQVAPTIITSLQTPGEPPFYAHVAKHLRRFKNPPVDTWVAFSQNKRSYKAW 81  Lactobacillus p...
Q03R06         2 YQDQDFQVFEDQTLAGRLGKIQKQIDPKFLITAGDLEPVLA-ELSVPIYQHVSQHRRRTKNPPTDTWIAFSTSKRGYKML 80  Lactobacillus b...
Q38XD7         2 FTRADFEIFDDPTLKGRLNKIYTELDPKFEVFGAQLQNELAVATNREFTLHIAKHLRRFKNPPMNTWMALSESSRGYKMM 81  Lactobacillus s...
WP_012726669   2 FTTKQFNVFKQDGLDERMSGIRSDIQPLFHRIYDEVGPELEADVGIPLYLHVAKHARRTVNPPKDTWMAICHDKRGYKKH 81  Exiguobacterium
Q8Y853         6 FSKKDFKTMQISGLEARMTGIQNDIQPKFRAVGEELTTYLSAKLGDEMFLHIARHQRRSVNPPDSTWLAICHDKRGYKKH 85  Listeria monocy...
WP_015845383  13 FEQMDFDTFLIEGLEQRMAAIEERIRPKFRYLGEKLAGDIAVQAGDEMFLHIAKHARRTVNPPKDTWLAICNNKRGYKAH 92  Paenibacillus s...
Q5WFC0         6 FTKSDFETFLIDGLEERMAAIRSNIQPKFQVIGAELRDELSTLLGNEMFLHIAQHARRTTNPPNDTWLAVAGNKRGYKKH 85  Bacillus clausi...
WP_013489244   6 FSQKDFDTFQIDGLDERMSAIQERIQPKFKAISEEIINDLSDMVGHEMFLHVAKHARRKVNPPKDTWSAYCHNKRGYKKH 85  Bacillus cellul...
WP_013172546   6 FNETDFETFSIEGLDERMTAIQERIQPKFKALSDSIIPELESITGSDMHLHVARHARRKVNPPQDTWSAYCHNKRGYKKH 85  [Bacillus] sele...
2A8E_A        86 PHFQIGLWESHVFVWFAIIYESPIKEEYGKLLEVNqE-TITKNIPDSFVWSADHTKPGVHKQSEXdkeQLKTLFeRLQTV 164 Bacillus subtilis
Q88UW9        82 PHFELGLWPDRLFIYFDILDECKPAVQ-AKMQLADlT-PLLKALPAGYVISNNHGVPAT---QLAtpaNITQAIkKFNQY 156 Lactobacillus p...
Q03R06        81 PHLEIGFWDDRFFIWLAVLQEAKNR----QGLLGQvQlADVLNLPSTFECGNDHADKNCGRPLTL---TNYQALmREQVN 153 Lactobacillus b...
Q38XD7        82 PHFEVGFGDDRIFVWFALMAEMPDKTDYAPLLASQsE-KLLSDF-TDYDLSYDHMTKQKFPMSp---dNLQLIQdKFAKT 156 Lactobacillus s...
WP_012726669  82 PHLQVGLFDDRVFIWLAFIYEMPNKDAIAKHLQQI---DLKSTFP-DFHIAGDHMKKEALLVEDTsteDIQSLLeRFGTV 157 Exiguobacterium
Q8Y853        86 PHFQVGLFDKYLFIWLAFIYENEESLKIANRFLKE-K-KLLADLPDNFAISPDHTEEKTYPVHDG---QLEATLeRFRDV 160 Listeria monocy...
WP_015845383  93 PHFQLGLFDDHLFLWFALIYEAPNKSKIASIYLDHlD-EVIAAVPSDYALSLDHMKKESKSVSEMnkqDWINALtRLRDV 171 Paenibacillus s...
Q5WFC0        86 PHFQVGLFDDHLFIWLAFIYELPEKGNIAKTFLENkP-LIEEVVPSDYVVSIDHTKKEANPLSEL---DLTQSLeRFRDV 161 Bacillus clausi...
WP_013489244  86 PHFQIGVFDDHMFIWLAYIYELPNKAEIATALLDNiD-SIIENIPNDYVLSLDHMEKKAESLQTI---DLTGALeRFRDV 161 Bacillus cellul...
WP_013172546  86 PHFQIGLFDDHVFIWLAHIYELPHKEDIADRFIENkS-SILETLPGDFDISMDHMKKPSQKVSEI---DLDDTLkRFKEV 161 [Bacillus] sele...
2A8E_A       165 KKAELLCGIQLQKEEVLN-XNNQeFLQRIDDAFKQLAFLY 203 Bacillus subtilis
Q88UW9       157 KHSELVVGRAVLVGDPLF-ENADtLNKLIIATFKQLLSIY 195 Lactobacillus plantarum WCFS1
Q03R06       154 RHAEWQLGRNFMRGSDLFtTTPDdQAAIIRDTVAALLPIY 193 Lactobacillus brevis ATCC 367
Q38XD7       157 KKGEWLLGKVYLKDNPLF-DHPEeLMADIQTTLLKMVPLY 195 Lactobacillus sakei subsp. sakei 23K
WP_012726669 158 KKADFLIGRQLPADASIL-QNEDaFLALVEDTFGRLTPLY 196 Exiguobacterium
Q8Y853       161 KKGEFLVGKIYLPDDNHL-SPAKdFIKEAEMVLDELIPLY 199 Listeria monocytogenes EGD-e
WP_015845383 172 QKAELLIGRHLPAGDPLL-HDGDaLYKLAQDTYETLMPLY 210 Paenibacillus sp. JDR-2
Q5WFC0       162 KKAEWLVGRHFAKGSETV-ENGEqLMEAIRQTVKTLLPLY 200 Bacillus clausii KSM-K16
WP_013489244 162 KKGEFLIGRHISANDPLL-QDGDkLIAYIRDTFQTLTPIY 200 Bacillus cellulosilyticus
WP_013172546 162 KKGEFLVGRKIDSADPLL-KDSEaFIKTVIDTFQTVAPLY 200 [Bacillus] selenitireducens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap